Opened 4 years ago
Last modified 4 years ago
#8211 assigned defect
Error running second AlphaFold job before first completes
| Reported by: | Owned by: | Tom Goddard | |
|---|---|---|---|
| Priority: | normal | Milestone: | |
| Component: | Structure Prediction | Version: | |
| Keywords: | Cc: | ||
| Blocked By: | Blocking: | ||
| Notify when closed: | Platform: | all | |
| Project: | ChimeraX |
Description
The following bug report has been submitted:
Platform: macOS-12.6-x86_64-i386-64bit
ChimeraX Version: 1.6.dev202211082330 (2022-11-08 23:30:49 UTC)
Description
Running a second AlphaFold prediction while the first is still running causes the Colab job to raise an error. I thought ChimeraX was supposed to say a job was already running.
Please cite ColabFold: Making protein folding accessible to all. Nature Methods (2022) if you use these predictions.
INFO:__main__:Starting prediction on 2022-12-16 UTC time
INFO:__main__:Installing ColabFold on Google Colab virtual machine.
Installing ColabFold
/usr/local/lib/python3.8/dist-packages/Bio/Data/SCOPData.py:18: BiopythonDeprecationWarning: The 'Bio.Data.SCOPData' module will be deprecated in a future release of Biopython in favor of 'Bio.Data.PDBData.
warnings.warn(
Using Tesla T4 graphics processor
Downloading alphafold2 weights to .: 100%|██████████| 3.47G/3.47G [00:41<00:00, 89.8MB/s]
2022-12-16 20:23:07,027 Found 5 citations for tools or databases
2022-12-16 20:23:07,040 Unable to initialize backend 'tpu_driver': NOT_FOUND: Unable to find driver in registry given worker:
2022-12-16 20:23:07,883 Unable to initialize backend 'rocm': NOT_FOUND: Could not find registered platform with name: "rocm". Available platform names are: CUDA Interpreter Host
2022-12-16 20:23:07,884 Unable to initialize backend 'tpu': module 'jaxlib.xla_extension' has no attribute 'get_tpu_client'
2022-12-16 20:23:07,885 Unable to initialize backend 'plugin': xla_extension has no attributes named get_plugin_device_client. Compile TensorFlow with //tensorflow/compiler/xla/python:enable_plugin_device set to true (defaults to false) to enable this.
2022-12-16 20:23:13,175 Query 1/1: af222 (length 222)
COMPLETE: 100%|██████████| 150/150 [elapsed: 00:02 remaining: 00:00]

2022-12-16 20:23:19,230 Running model_1
---------------------------------------------------------------------------
KeyboardInterrupt Traceback (most recent call last)
<ipython-input-1-d3d257c6040c> in <module>
411 remove_from_list(seq_list, 'prokaryote') # Obsolete "prokaryote" flag
412
--> 413 run_prediction(seq_list, use_templates = use_templates, energy_minimize = not dont_minimize)
13 frames
<ipython-input-1-d3d257c6040c> in run_prediction(sequences, job_name, msa_mode, pair_mode, use_templates, custom_template_path, energy_minimize, model_type, num_recycles, dpi, install_log)
77
78 from colabfold.batch import run
---> 79 run(
80 queries=queries,
81 result_dir='.',
/usr/local/lib/python3.8/dist-packages/colabfold/batch.py in run(queries, result_dir, num_models, num_recycles, model_order, is_complex, num_ensemble, model_type, msa_mode, use_templates, custom_template_path, use_amber, keep_existing_results, rank_by, pair_mode, data_dir, host_url, random_seed, stop_at_score, recompile_padding, recompile_all_models, zip_results, prediction_callback, save_single_representations, save_pair_representations, training, use_gpu_relax, stop_at_score_below, dpi, max_msa)
1392 crop_len = math.ceil(sum(query_sequence_len_array) * recompile_padding)
1393
-> 1394 outs, model_rank = predict_structure(
1395 jobname,
1396 result_dir,
/usr/local/lib/python3.8/dist-packages/colabfold/batch.py in predict_structure(prefix, result_dir, feature_dict, is_complex, use_templates, sequences_lengths, crop_len, model_type, model_runner_and_params, do_relax, rank_by, random_seed, stop_at_score, stop_at_score_below, prediction_callback, use_gpu_relax)
357 # The original alphafold only returns the prediction_result,
358 # but our patched alphafold also returns a tuple (recycles,tol)
--> 359 prediction_result, recycles = model_runner.predict(
360 input_features, random_seed=random_seed
361 )
/usr/local/lib/python3.8/dist-packages/alphafold/model/model.py in predict(self, feat, random_seed)
192
193 sub_feat["prev"] = result["prev"]
--> 194 result, _ = self.apply(self.params, key, sub_feat)
195 confidences = get_confidence_metrics(result, multimer_mode=self.multimer_mode)
196 if self.config.model.stop_at_score_ranker == "plddt":
/usr/local/lib/python3.8/dist-packages/jax/_src/traceback_util.py in reraise_with_filtered_traceback(*args, **kwargs)
160 __tracebackhide__ = True
161 try:
--> 162 return fun(*args, **kwargs)
163 except Exception as e:
164 mode = filtering_mode()
/usr/local/lib/python3.8/dist-packages/jax/_src/api.py in cache_miss(*args, **kwargs)
618 if isinstance(top_trace, core.EvalTrace) and not (
619 jax.config.jax_debug_nans or jax.config.jax_debug_infs):
--> 620 execute = dispatch._xla_call_impl_lazy(fun_, *tracers, **params)
621 out_flat = call_bind_continuation(execute(*args_flat))
622 else:
/usr/local/lib/python3.8/dist-packages/jax/_src/dispatch.py in _xla_call_impl_lazy(***failed resolving arguments***)
234 raise NotImplementedError('Dynamic shapes do not work with Array.')
235 arg_specs = [(None, getattr(x, '_device', None)) for x in args]
--> 236 return xla_callable(fun, device, backend, name, donated_invars, keep_unused,
237 *arg_specs)
238
/usr/local/lib/python3.8/dist-packages/jax/linear_util.py in memoized_fun(fun, *args)
298 fun.populate_stores(stores)
299 else:
--> 300 ans = call(fun, *args)
301 cache[key] = (ans, fun.stores)
302
/usr/local/lib/python3.8/dist-packages/jax/_src/dispatch.py in _xla_callable_uncached(fun, device, backend, name, donated_invars, keep_unused, *arg_specs)
357 return computation.compile(_allow_propagation_to_outputs=True).unsafe_call
358 else:
--> 359 return lower_xla_callable(fun, device, backend, name, donated_invars, False,
360 keep_unused, *arg_specs).compile().unsafe_call
361
/usr/local/lib/python3.8/dist-packages/jax/_src/dispatch.py in compile(self)
994 else:
995 assert self._out_type is not None
--> 996 self._executable = XlaCompiledComputation.from_xla_computation(
997 self.name, self._hlo, self._in_type, self._out_type,
998 **self.compile_args)
/usr/local/lib/python3.8/dist-packages/jax/_src/dispatch.py in from_xla_computation(name, xla_computation, in_type, out_type, nreps, device, backend, tuple_args, in_avals, out_avals, has_unordered_effects, ordered_effects, kept_var_idx, keepalive, host_callbacks)
1192 with log_elapsed_time(f"Finished XLA compilation of {name} "
1193 "in {elapsed_time} sec"):
-> 1194 compiled = compile_or_get_cached(backend, xla_computation, options,
1195 host_callbacks)
1196 buffer_counts = get_buffer_counts(out_avals, ordered_effects,
/usr/local/lib/python3.8/dist-packages/jax/_src/dispatch.py in compile_or_get_cached(backend, computation, compile_options, host_callbacks)
1075 return compiled
1076
-> 1077 return backend_compile(backend, serialized_computation, compile_options,
1078 host_callbacks)
1079
/usr/local/lib/python3.8/dist-packages/jax/_src/profiler.py in wrapper(*args, **kwargs)
312 def wrapper(*args, **kwargs):
313 with TraceAnnotation(name, **decorator_kwargs):
--> 314 return func(*args, **kwargs)
315 return wrapper
316 return wrapper
/usr/local/lib/python3.8/dist-packages/jax/_src/dispatch.py in backend_compile(backend, built_c, options, host_callbacks)
1010 # TODO(sharadmv): remove this fallback when all backends allow `compile`
1011 # to take in `host_callbacks`
-> 1012 return backend.compile(built_c, compile_options=options)
1013
1014 # TODO(phawkins): update users.
KeyboardInterrupt:
Log:
Could not find tool "Tabbed Toolbar"
UCSF ChimeraX version: 1.6.dev202211082330 (2022-11-08)
© 2016-2022 Regents of the University of California. All rights reserved.
How to cite UCSF ChimeraX
> ui tool show AlphaFold
> alphafold predict
> DLPKSVDWRKKGYVTPVKNQKQCGSSWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDEICKYRPENSVAQDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNV
Please cite ColabFold: Making protein folding accessible to all. Nature
Methods (2022) if you use these predictions.
Running AlphaFold prediction
> alphafold predict
> MELALRGGYRERPNHQEDPKYLELAHYATSTWSAQQPGKTPFDTVVEVLKVETQTVAGTNYRLTLKVAESTCELTSTYSKDACQPNANAAQRTCTTVIYQNLEGEKSVSSFGCAAA
Running AlphaFold prediction
Populating font family aliases took 370 ms. Replace uses of missing font
family "Roboto" with one that exists to avoid this cost.
OpenGL version: 4.1 ATI-4.8.101
OpenGL renderer: AMD Radeon Pro 580 OpenGL Engine
OpenGL vendor: ATI Technologies Inc.
Python: 3.9.11
Locale: UTF-8
Qt version: PyQt6 6.3.1, Qt 6.3.1
Qt runtime version: 6.3.2
Qt platform: cocoa
Hardware:
Hardware Overview:
Model Name: iMac
Model Identifier: iMac18,3
Processor Name: Quad-Core Intel Core i7
Processor Speed: 4.2 GHz
Number of Processors: 1
Total Number of Cores: 4
L2 Cache (per Core): 256 KB
L3 Cache: 8 MB
Hyper-Threading Technology: Enabled
Memory: 32 GB
System Firmware Version: 451.140.1.0.0
OS Loader Version: 540.120.3~22
SMC Version (system): 2.41f2
Software:
System Software Overview:
System Version: macOS 12.6 (21G115)
Kernel Version: Darwin 21.6.0
Time since boot: 86 days 17:14
Graphics/Displays:
Radeon Pro 580:
Chipset Model: Radeon Pro 580
Type: GPU
Bus: PCIe
PCIe Lane Width: x16
VRAM (Total): 8 GB
Vendor: AMD (0x1002)
Device ID: 0x67df
Revision ID: 0x00c0
ROM Revision: 113-D000AA-931
VBIOS Version: 113-D0001A1X-025
EFI Driver Version: 01.00.931
Metal Family: Supported, Metal GPUFamily macOS 2
Displays:
iMac:
Display Type: Built-In Retina LCD
Resolution: Retina 5K (5120 x 2880)
Framebuffer Depth: 30-Bit Color (ARGB2101010)
Main Display: Yes
Mirror: Off
Online: Yes
Automatically Adjust Brightness: Yes
Connection Type: Internal
Installed Packages:
alabaster: 0.7.12
appdirs: 1.4.4
appnope: 0.1.3
asttokens: 2.0.8
Babel: 2.10.3
backcall: 0.2.0
blockdiag: 3.0.0
build: 0.8.0
certifi: 2022.9.24
cftime: 1.6.2
charset-normalizer: 2.1.1
ChimeraX-AddCharge: 1.4
ChimeraX-AddH: 2.2
ChimeraX-AlignmentAlgorithms: 2.0
ChimeraX-AlignmentHdrs: 3.2.2
ChimeraX-AlignmentMatrices: 2.1
ChimeraX-Alignments: 2.7
ChimeraX-AlphaFold: 1.0
ChimeraX-AltlocExplorer: 1.0.3
ChimeraX-AmberInfo: 1.0
ChimeraX-Arrays: 1.0
ChimeraX-Atomic: 1.43.4
ChimeraX-AtomicLibrary: 8.0.4
ChimeraX-AtomSearch: 2.0.1
ChimeraX-AxesPlanes: 2.3
ChimeraX-BasicActions: 1.1.2
ChimeraX-BILD: 1.0
ChimeraX-BlastProtein: 2.1.2
ChimeraX-BondRot: 2.0.1
ChimeraX-BugReporter: 1.0.1
ChimeraX-BuildStructure: 2.7.1
ChimeraX-Bumps: 1.0
ChimeraX-BundleBuilder: 1.2
ChimeraX-ButtonPanel: 1.0.1
ChimeraX-CageBuilder: 1.0.1
ChimeraX-CellPack: 1.0
ChimeraX-Centroids: 1.3.1
ChimeraX-ChangeChains: 1.0.2
ChimeraX-CheckWaters: 1.3
ChimeraX-ChemGroup: 2.0
ChimeraX-Clashes: 2.2.4
ChimeraX-ColorActions: 1.0.3
ChimeraX-ColorGlobe: 1.0
ChimeraX-ColorKey: 1.5.2
ChimeraX-CommandLine: 1.2.4
ChimeraX-ConnectStructure: 2.0.1
ChimeraX-Contacts: 1.0.1
ChimeraX-Core: 1.6.dev202211082330
ChimeraX-CoreFormats: 1.1
ChimeraX-coulombic: 1.3.2
ChimeraX-Crosslinks: 1.0
ChimeraX-Crystal: 1.0
ChimeraX-CrystalContacts: 1.0.1
ChimeraX-DataFormats: 1.2.2
ChimeraX-Dicom: 1.1
ChimeraX-DistMonitor: 1.3
ChimeraX-DockPrep: 1.0
ChimeraX-Dssp: 2.0
ChimeraX-EMDB-SFF: 1.0
ChimeraX-ESMFold: 1.0
ChimeraX-ExperimentalCommands: 1.0
ChimeraX-FileHistory: 1.0.1
ChimeraX-FunctionKey: 1.0.1
ChimeraX-Geometry: 1.2
ChimeraX-gltf: 1.0
ChimeraX-Graphics: 1.1
ChimeraX-Hbonds: 2.4
ChimeraX-Help: 1.2.1
ChimeraX-HKCage: 1.3
ChimeraX-IHM: 1.1
ChimeraX-ImageFormats: 1.2
ChimeraX-IMOD: 1.0
ChimeraX-IO: 1.0.1
ChimeraX-ItemsInspection: 1.0.1
ChimeraX-Label: 1.1.7
ChimeraX-ListInfo: 1.1.1
ChimeraX-Log: 1.1.5
ChimeraX-LookingGlass: 1.1
ChimeraX-Maestro: 1.8.2
ChimeraX-Map: 1.1.3
ChimeraX-MapData: 2.0
ChimeraX-MapEraser: 1.0.1
ChimeraX-MapFilter: 2.0
ChimeraX-MapFit: 2.0
ChimeraX-MapSeries: 2.1.1
ChimeraX-Markers: 1.0.1
ChimeraX-Mask: 1.0.1
ChimeraX-MatchMaker: 2.0.9
ChimeraX-MDcrds: 2.6
ChimeraX-MedicalToolbar: 1.0.2
ChimeraX-Meeting: 1.0.1
ChimeraX-MLP: 1.1
ChimeraX-mmCIF: 2.9
ChimeraX-MMTF: 2.2
ChimeraX-Modeller: 1.5.6
ChimeraX-ModelPanel: 1.3.6
ChimeraX-ModelSeries: 1.0.1
ChimeraX-Mol2: 2.0
ChimeraX-Mole: 1.0
ChimeraX-Morph: 1.0.1
ChimeraX-MouseModes: 1.1.1
ChimeraX-Movie: 1.0
ChimeraX-Neuron: 1.0
ChimeraX-Nucleotides: 2.0.3
ChimeraX-OpenCommand: 1.9.1
ChimeraX-PDB: 2.6.8
ChimeraX-PDBBio: 1.0
ChimeraX-PDBLibrary: 1.0.2
ChimeraX-PDBMatrices: 1.0
ChimeraX-PickBlobs: 1.0.1
ChimeraX-Positions: 1.0
ChimeraX-PresetMgr: 1.1
ChimeraX-PubChem: 2.1
ChimeraX-ReadPbonds: 1.0.1
ChimeraX-Registration: 1.1.1
ChimeraX-RemoteControl: 1.0
ChimeraX-RenderByAttr: 1.0
ChimeraX-RenumberResidues: 1.1
ChimeraX-ResidueFit: 1.0.1
ChimeraX-RestServer: 1.1
ChimeraX-RNALayout: 1.0
ChimeraX-RotamerLibMgr: 2.0.1
ChimeraX-RotamerLibsDunbrack: 2.0
ChimeraX-RotamerLibsDynameomics: 2.0
ChimeraX-RotamerLibsRichardson: 2.0
ChimeraX-SaveCommand: 1.5.1
ChimeraX-SchemeMgr: 1.0
ChimeraX-SDF: 2.0
ChimeraX-Segger: 1.0
ChimeraX-Segment: 1.0
ChimeraX-SelInspector: 1.0
ChimeraX-SeqView: 2.7.3
ChimeraX-Shape: 1.0.1
ChimeraX-Shell: 1.0.1
ChimeraX-Shortcuts: 1.1.1
ChimeraX-ShowSequences: 1.0.1
ChimeraX-SideView: 1.0.1
ChimeraX-Smiles: 2.1
ChimeraX-SmoothLines: 1.0
ChimeraX-SpaceNavigator: 1.0
ChimeraX-StdCommands: 1.10.1
ChimeraX-STL: 1.0
ChimeraX-Storm: 1.0
ChimeraX-StructMeasure: 1.1
ChimeraX-Struts: 1.0.1
ChimeraX-Surface: 1.0
ChimeraX-SwapAA: 2.0.1
ChimeraX-SwapRes: 2.1.3
ChimeraX-TapeMeasure: 1.0
ChimeraX-Test: 1.0
ChimeraX-Toolbar: 1.1.2
ChimeraX-ToolshedUtils: 1.2.1
ChimeraX-Topography: 1.0
ChimeraX-Tug: 1.0.1
ChimeraX-UI: 1.24.2
ChimeraX-uniprot: 2.2.1
ChimeraX-UnitCell: 1.0.1
ChimeraX-ViewDockX: 1.1.3
ChimeraX-VIPERdb: 1.0
ChimeraX-Vive: 1.1
ChimeraX-VolumeMenu: 1.0.1
ChimeraX-VTK: 1.0
ChimeraX-WavefrontOBJ: 1.0
ChimeraX-WebCam: 1.0.1
ChimeraX-WebServices: 1.1.0
ChimeraX-Zone: 1.0.1
colorama: 0.4.5
contourpy: 1.0.6
cxservices: 1.2
cycler: 0.11.0
Cython: 0.29.32
debugpy: 1.6.3
decorator: 5.1.1
docutils: 0.19
entrypoints: 0.4
executing: 1.1.1
filelock: 3.7.1
fonttools: 4.37.4
funcparserlib: 1.0.0
grako: 3.16.5
h5py: 3.7.0
html2text: 2020.1.16
idna: 3.4
ihm: 0.35
imagecodecs: 2022.9.26
imagesize: 1.4.1
importlib-metadata: 5.0.0
ipykernel: 6.15.3
ipython: 8.4.0
ipython-genutils: 0.2.0
jedi: 0.18.1
Jinja2: 3.1.2
jupyter-client: 7.3.4
jupyter-core: 4.11.2
kiwisolver: 1.4.4
line-profiler: 3.5.1
lxml: 4.9.1
lz4: 4.0.2
MarkupSafe: 2.1.1
matplotlib: 3.6.2
matplotlib-inline: 0.1.6
msgpack: 1.0.4
nest-asyncio: 1.5.6
netCDF4: 1.6.0
networkx: 2.8.8
numexpr: 2.8.3
numpy: 1.23.5
openvr: 1.23.701
opt-einsum: 3.3.0
packaging: 21.3
ParmEd: 3.4.3
parso: 0.8.3
pep517: 0.13.0
pexpect: 4.8.0
pickleshare: 0.7.5
Pillow: 9.3.0
pip: 22.2.2
pkginfo: 1.8.3
prompt-toolkit: 3.0.31
psutil: 5.9.4
ptyprocess: 0.7.0
pure-eval: 0.2.2
pycollada: 0.7.2
pydicom: 2.3.0
Pygments: 2.12.0
PyOpenGL: 3.1.5
PyOpenGL-accelerate: 3.1.5
pyparsing: 3.0.9
PyQt6: 6.3.1
PyQt6-Qt6: 6.3.2
PyQt6-sip: 13.4.0
PyQt6-WebEngine: 6.3.1
PyQt6-WebEngine-Qt6: 6.3.2
python-dateutil: 2.8.2
pytz: 2022.5
pyzmq: 24.0.1
qtconsole: 5.3.1
QtPy: 2.2.1
RandomWords: 0.4.0
requests: 2.28.1
scipy: 1.9.3
setuptools: 65.1.1
setuptools-scm: 7.0.5
sfftk-rw: 0.7.2
six: 1.16.0
snowballstemmer: 2.2.0
sortedcontainers: 2.4.0
Sphinx: 5.1.1
sphinx-autodoc-typehints: 1.19.1
sphinxcontrib-applehelp: 1.0.2
sphinxcontrib-blockdiag: 3.0.0
sphinxcontrib-devhelp: 1.0.2
sphinxcontrib-htmlhelp: 2.0.0
sphinxcontrib-jsmath: 1.0.1
sphinxcontrib-qthelp: 1.0.3
sphinxcontrib-serializinghtml: 1.1.5
stack-data: 0.5.1
tables: 3.7.0
tifffile: 2022.10.10
tinyarray: 1.2.4
tomli: 2.0.1
tornado: 6.2
traitlets: 5.3.0
typing-extensions: 4.4.0
urllib3: 1.26.12
wcwidth: 0.2.5
webcolors: 1.12
wheel: 0.37.1
wheel-filename: 1.4.1
zipp: 3.9.0
Change History (2)
comment:1 by , 4 years ago
| Component: | Unassigned → Structure Prediction |
|---|---|
| Owner: | set to |
| Platform: | → all |
| Project: | → ChimeraX |
| Status: | new → assigned |
| Summary: | ChimeraX bug report submission → Error running second AlphaFold job before first completes |
comment:2 by , 4 years ago
Note:
See TracTickets
for help on using tickets.
The AlphaFoldRun class never sets its _running attribute to True. I'm not sure why. It is easy to set it to true when the run starts and false when the run ends. But how to I handle the case where the run failed and nothing was downloaded? Then _running will never be set to false and the user will not be able to run another AlphaFold job unless they restart ChimeraX. That may be why I took out code that set _running to true. Maybe there is some way to see that colab has stopped executing Python.