Opened 22 months ago
Closed 20 months ago
#15704 closed defect (fixed)
BLAST databases missing
| Reported by: | Owned by: | Zach Pearson | |
|---|---|---|---|
| Priority: | normal | Milestone: | |
| Component: | Web Services | Version: | |
| Keywords: | Cc: | Greg Couch, Scooter Morris | |
| Blocked By: | Blocking: | ||
| Notify when closed: | Platform: | all | |
| Project: | ChimeraX |
Description
The following bug report has been submitted:
Platform: Windows-10-10.0.22631
ChimeraX Version: 1.8 (2024-06-10 23:15:52 UTC)
Description
BlastProtein failed: 'bytes' object has no attribute 'items'
Parsing BlastProtein results failed: 'NoneType' object has no attribute 'keys'
Log:
UCSF ChimeraX version: 1.8 (2024-06-10)
© 2016-2024 Regents of the University of California. All rights reserved.
> ~select
Nothing selected
Log from Tue Jul 30 16:37:05 2024 Startup Messages
---
note | available bundle cache has not been initialized yet
UCSF ChimeraX version: 1.8 (2024-06-10)
© 2016-2024 Regents of the University of California. All rights reserved.
How to cite UCSF ChimeraX
> open "C:/Users/USER/OneDrive - The Hong Kong Polytechnic University/Lab
> Documents/Log book/Log Ubi/Ubi coot/Ubi with
> uq/RRS61_with_UQplaceholder.pdb"
Chain information for RRS61_with_UQplaceholder.pdb #1
---
Chain | Description
A B C | No description available
D | No description available
E | No description available
F | No description available
G | No description available
H | No description available
I | No description available
J K | No description available
> hide atoms
> show cartoons
> ui tool show "Blast Protein"
[Repeated 1 time(s)]
> ui tool show "Show Sequence Viewer"
> sequence chain /A /B /C
Alignment identifier is 1
> blastprotein /A database pdb cutoff 1e-3 matrix BLOSUM62 maxSeqs 100 version
> None name bp1
Webservices job id: VG9FUD493YU3WEPD
Alignment identifier is bp1 [1]
Associated RRS61_with_UQplaceholder.pdb chain A to #1/A with 0 mismatches
Associated RRS61_with_UQplaceholder.pdb chain B to #1/A with 0 mismatches
Associated RRS61_with_UQplaceholder.pdb chain C to #1/A with 0 mismatches
Showing conservation header ("seq_conservation" residue attribute) for
alignment bp1 [1]
> open pdb:4OBW
4obw title:
crystal structure of yeast Coq5 in the SAM bound form [more info...]
Chain information for 4obw #2
---
Chain | Description | UniProt
A B C D | 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial | COQ5_YEAST 61-307
Non-standard residues in 4obw #2
---
SAM — S-adenosylmethionine
TAM — tris(hydroxyethyl)aminomethane
4obw mmCIF Assemblies
---
1| author_and_software_defined_assembly
2| author_and_software_defined_assembly
Associated 4obw chain A to 4OBX_A with 0 mismatches
Associated 4obw chain D to 4OBX_A with 0 mismatches
Associated 4obw chain C to 4OBX_A with 0 mismatches
Associated 4obw chain B to 4OBX_A with 0 mismatches
> matchmaker #2/A to #1/A
Parameters
---
Chain pairing | bb
Alignment algorithm | Needleman-Wunsch
Similarity matrix | BLOSUM-62
SS fraction | 0.3
Gap open (HH/SS/other) | 18/18/6
Gap extend | 1
SS matrix | | | H | S | O
---|---|---|---
H | 6 | -9 | -6
S | | 6 | -6
O | | | 4
Iteration cutoff | 2
Matchmaker RRS61_with_UQplaceholder.pdb, chain A (#1) with 4OBW_A, chain A
(#2), sequence alignment score = 582.7
RMSD between 141 pruned atom pairs is 0.905 angstroms; (across all 219 pairs:
3.373)
> open pdb:4OBX
Summary of feedback from opening 4OBX fetched from pdb
---
note | Fetching compressed mmCIF 4obx from http://files.rcsb.org/download/4obx.cif
4obx title:
Crystal structure of yeast Coq5 in the apo form [more info...]
Chain information for 4obx #3
---
Chain | Description | UniProt
A B C D | 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial | COQ5_YEAST 61-307
Non-standard residues in 4obx #3
---
TAM — tris(hydroxyethyl)aminomethane
4obx mmCIF Assemblies
---
1| author_and_software_defined_assembly
2| author_and_software_defined_assembly
Associated 4obx chain A to 4OBX_A with 0 mismatches
Associated 4obx chain D to 4OBX_A with 0 mismatches
Associated 4obx chain C to 4OBX_A with 0 mismatches
Associated 4obx chain B to 4OBX_A with 0 mismatches
> matchmaker #3/A to #1/A
Parameters
---
Chain pairing | bb
Alignment algorithm | Needleman-Wunsch
Similarity matrix | BLOSUM-62
SS fraction | 0.3
Gap open (HH/SS/other) | 18/18/6
Gap extend | 1
SS matrix | | | H | S | O
---|---|---|---
H | 6 | -9 | -6
S | | 6 | -6
O | | | 4
Iteration cutoff | 2
Matchmaker RRS61_with_UQplaceholder.pdb, chain A (#1) with 4OBX_A, chain A
(#3), sequence alignment score = 588.1
RMSD between 140 pruned atom pairs is 0.967 angstroms; (across all 220 pairs:
3.416)
> open pdb:3DH0
Summary of feedback from opening 3DH0 fetched from pdb
---
note | Fetching compressed mmCIF 3dh0 from http://files.rcsb.org/download/3dh0.cif
3dh0 title:
Crystal structure of a SAM dependent methyltransferase from Aquifex aeolicus
[more info...]
Chain information for 3dh0 #4
---
Chain | Description | UniProt
A B | SAM dependent methyltransferase | O67440_AQUAE 4-211
Non-standard residues in 3dh0 #4
---
SAM — S-adenosylmethionine
3dh0 mmCIF Assemblies
---
1| author_and_software_defined_assembly
2| author_and_software_defined_assembly
Associated 3dh0 chain A to 3DH0_A with 0 mismatches
Associated 3dh0 chain B to 3DH0_A with 0 mismatches
> matchmaker #4/A to #1/A
Parameters
---
Chain pairing | bb
Alignment algorithm | Needleman-Wunsch
Similarity matrix | BLOSUM-62
SS fraction | 0.3
Gap open (HH/SS/other) | 18/18/6
Gap extend | 1
SS matrix | | | H | S | O
---|---|---|---
H | 6 | -9 | -6
S | | 6 | -6
O | | | 4
Iteration cutoff | 2
Matchmaker RRS61_with_UQplaceholder.pdb, chain A (#1) with 3DH0_A, chain A
(#4), sequence alignment score = 293.4
RMSD between 97 pruned atom pairs is 1.168 angstroms; (across all 180 pairs:
5.419)
> open pdb:1XXL
Summary of feedback from opening 1XXL fetched from pdb
---
notes | Fetching compressed mmCIF 1xxl from http://files.rcsb.org/download/1xxl.cif
Fetching CCD SO4 from
https://files.wwpdb.org/pub/pdb/refdata/chem_comp/4/SO4/SO4.cif
1xxl title:
The crystal structure of YcgJ protein from Bacillus subitilis at 2.1 A
resolution [more info...]
Chain information for 1xxl #5
---
Chain | Description | UniProt
A B | YcgJ protein | O31474_BACSU 2-228
Non-standard residues in 1xxl #5
---
SO4 — sulfate ion
1xxl mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
Associated 1xxl chain A to 2GLU_A with 1 mismatch
Associated 1xxl chain B to 2GLU_A with 1 mismatch
> matchmaker #5/A to #1/A
Parameters
---
Chain pairing | bb
Alignment algorithm | Needleman-Wunsch
Similarity matrix | BLOSUM-62
SS fraction | 0.3
Gap open (HH/SS/other) | 18/18/6
Gap extend | 1
SS matrix | | | H | S | O
---|---|---|---
H | 6 | -9 | -6
S | | 6 | -6
O | | | 4
Iteration cutoff | 2
Matchmaker RRS61_with_UQplaceholder.pdb, chain A (#1) with 1XXL_A, chain A
(#5), sequence alignment score = 279.3
RMSD between 124 pruned atom pairs is 0.960 angstroms; (across all 190 pairs:
12.711)
> open pdb:2GLU
Summary of feedback from opening 2GLU fetched from pdb
---
note | Fetching compressed mmCIF 2glu from http://files.rcsb.org/download/2glu.cif
2glu title:
The crystal structure of YcgJ protein from Bacillus subitilis [more info...]
Chain information for 2glu #6
---
Chain | Description
A B | ycgJ
Non-standard residues in 2glu #6
---
SAM — S-adenosylmethionine
SO4 — sulfate ion
2glu mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
Associated 2glu chain A to 2GLU_A with 1 mismatch
Associated 2glu chain B to 2GLU_A with 1 mismatch
> matchmaker #6/A to #1/A
Parameters
---
Chain pairing | bb
Alignment algorithm | Needleman-Wunsch
Similarity matrix | BLOSUM-62
SS fraction | 0.3
Gap open (HH/SS/other) | 18/18/6
Gap extend | 1
SS matrix | | | H | S | O
---|---|---|---
H | 6 | -9 | -6
S | | 6 | -6
O | | | 4
Iteration cutoff | 2
Matchmaker RRS61_with_UQplaceholder.pdb, chain A (#1) with 2GLU_A, chain A
(#6), sequence alignment score = 265.9
RMSD between 124 pruned atom pairs is 1.062 angstroms; (across all 169 pairs:
5.989)
> open pdb:6UAK
Summary of feedback from opening 6UAK fetched from pdb
---
warning | Atom OE2 has no neighbors to form bonds with according to residue template for GLU /A:251
note | Fetching compressed mmCIF 6uak from http://files.rcsb.org/download/6uak.cif
6uak title:
LahSb - C-terminal methyltransferase involved in RiPP biosynthesis [more
info...]
Chain information for 6uak #7
---
Chain | Description | UniProt
A | SAM dependent methyltransferase LahSB | A0A3D0LE54_9FIRM 4-306
Non-standard residues in 6uak #7
---
SAH — S-adenosyl-L-homocysteine
6uak mmCIF Assemblies
---
1| author_and_software_defined_assembly
Associated 6uak chain A to 6UAK_A with 0 mismatches
> matchmaker #7/A to #1/A
Parameters
---
Chain pairing | bb
Alignment algorithm | Needleman-Wunsch
Similarity matrix | BLOSUM-62
SS fraction | 0.3
Gap open (HH/SS/other) | 18/18/6
Gap extend | 1
SS matrix | | | H | S | O
---|---|---|---
H | 6 | -9 | -6
S | | 6 | -6
O | | | 4
Iteration cutoff | 2
Matchmaker RRS61_with_UQplaceholder.pdb, chain A (#1) with 6UAK_A, chain A
(#7), sequence alignment score = 302.9
RMSD between 91 pruned atom pairs is 1.138 angstroms; (across all 200 pairs:
10.323)
> open pdb:1VL5
Summary of feedback from opening 1VL5 fetched from pdb
---
warning | Atom O has no neighbors to form bonds with according to residue template for GLU /A:100
note | Fetching compressed mmCIF 1vl5 from http://files.rcsb.org/download/1vl5.cif
1vl5 title:
Crystal structure of A putative methyltransferase (BH2331) from bacillus
halodurans C-125 At 1.95 A resolution [more info...]
Chain information for 1vl5 #8
---
Chain | Description | UniProt
A B C D | unknown conserved protein BH2331 | Q9KAF6_BACHD 19-265
1vl5 mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
3| author_defined_assembly
4| author_defined_assembly
16 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Associated 1vl5 chain A to 1VL5_A with 1 mismatch
Associated 1vl5 chain B to 1VL5_A with 1 mismatch
Associated 1vl5 chain C to 1VL5_A with 1 mismatch
Associated 1vl5 chain D to 1VL5_A with 1 mismatch
> matchmaker #8/A to #1/A
Parameters
---
Chain pairing | bb
Alignment algorithm | Needleman-Wunsch
Similarity matrix | BLOSUM-62
SS fraction | 0.3
Gap open (HH/SS/other) | 18/18/6
Gap extend | 1
SS matrix | | | H | S | O
---|---|---|---
H | 6 | -9 | -6
S | | 6 | -6
O | | | 4
Iteration cutoff | 2
Matchmaker RRS61_with_UQplaceholder.pdb, chain A (#1) with 1VL5_A, chain A
(#8), sequence alignment score = 287.3
RMSD between 116 pruned atom pairs is 1.053 angstroms; (across all 173 pairs:
7.330)
> open pdb:3MGG
Summary of feedback from opening 3MGG fetched from pdb
---
note | Fetching compressed mmCIF 3mgg from http://files.rcsb.org/download/3mgg.cif
3mgg title:
Crystal Structure of Methyl Transferase from Methanosarcina mazei [more
info...]
Chain information for 3mgg #9
---
Chain | Description | UniProt
A B | Methyltransferase | Q8PVL4_METMA 2-266
Associated 3mgg chain A to 3MGG_A with 0 mismatches
Associated 3mgg chain B to 3MGG_A with 0 mismatches
> matchmaker #9/A to #1/A
Parameters
---
Chain pairing | bb
Alignment algorithm | Needleman-Wunsch
Similarity matrix | BLOSUM-62
SS fraction | 0.3
Gap open (HH/SS/other) | 18/18/6
Gap extend | 1
SS matrix | | | H | S | O
---|---|---|---
H | 6 | -9 | -6
S | | 6 | -6
O | | | 4
Iteration cutoff | 2
Matchmaker RRS61_with_UQplaceholder.pdb, chain A (#1) with 3MGG_A, chain A
(#9), sequence alignment score = 255.6
RMSD between 91 pruned atom pairs is 1.126 angstroms; (across all 172 pairs:
8.307)
> open pdb:6UV6
Summary of feedback from opening 6UV6 fetched from pdb
---
note | Fetching compressed mmCIF 6uv6 from http://files.rcsb.org/download/6uv6.cif
6uv6 title:
AtmM with bound rebeccamycin analogue [more info...]
Chain information for 6uv6 #10
---
Chain | Description | UniProt
A B C | D-glucose O-methyltransferase | Q0H2W9_9ACTN 1-268
Non-standard residues in 6uv6 #10
---
BY9 — 12-beta-D-
glucopyranosyl-12,13-dihydro-5H-indolo[2,3-a]pyrrolo[3,4-c]carbazole-5,7(6H)-dione
(rebeccamycin analogue)
SAH — S-adenosyl-L-homocysteine
6uv6 mmCIF Assemblies
---
1| author_and_software_defined_assembly
2| author_and_software_defined_assembly
3| author_and_software_defined_assembly
Associated 6uv6 chain A to 6UV6_A with 0 mismatches
Associated 6uv6 chain B to 6UV6_A with 0 mismatches
Associated 6uv6 chain C to 6UV6_A with 0 mismatches
> matchmaker #10/A to #1/A
Parameters
---
Chain pairing | bb
Alignment algorithm | Needleman-Wunsch
Similarity matrix | BLOSUM-62
SS fraction | 0.3
Gap open (HH/SS/other) | 18/18/6
Gap extend | 1
SS matrix | | | H | S | O
---|---|---|---
H | 6 | -9 | -6
S | | 6 | -6
O | | | 4
Iteration cutoff | 2
Matchmaker RRS61_with_UQplaceholder.pdb, chain A (#1) with 6UV6_A, chain A
(#10), sequence alignment score = 299
RMSD between 97 pruned atom pairs is 1.083 angstroms; (across all 206 pairs:
14.889)
> hide #2-6,9-10#!7-8 target m
> close #2-6,9-10#7-8
> open pdb:3DH0
3dh0 title:
Crystal structure of a SAM dependent methyltransferase from Aquifex aeolicus
[more info...]
Chain information for 3dh0 #2
---
Chain | Description | UniProt
A B | SAM dependent methyltransferase | O67440_AQUAE 4-211
Non-standard residues in 3dh0 #2
---
SAM — S-adenosylmethionine
3dh0 mmCIF Assemblies
---
1| author_and_software_defined_assembly
2| author_and_software_defined_assembly
Associated 3dh0 chain A to 3DH0_A with 0 mismatches
Associated 3dh0 chain B to 3DH0_A with 0 mismatches
> matchmaker #2/A to #1/A
Parameters
---
Chain pairing | bb
Alignment algorithm | Needleman-Wunsch
Similarity matrix | BLOSUM-62
SS fraction | 0.3
Gap open (HH/SS/other) | 18/18/6
Gap extend | 1
SS matrix | | | H | S | O
---|---|---|---
H | 6 | -9 | -6
S | | 6 | -6
O | | | 4
Iteration cutoff | 2
Matchmaker RRS61_with_UQplaceholder.pdb, chain A (#1) with 3DH0_A, chain A
(#2), sequence alignment score = 293.4
RMSD between 97 pruned atom pairs is 1.168 angstroms; (across all 180 pairs:
5.419)
> close #2
> open pdb:3DH0
3dh0 title:
Crystal structure of a SAM dependent methyltransferase from Aquifex aeolicus
[more info...]
Chain information for 3dh0 #2
---
Chain | Description | UniProt
A B | SAM dependent methyltransferase | O67440_AQUAE 4-211
Non-standard residues in 3dh0 #2
---
SAM — S-adenosylmethionine
3dh0 mmCIF Assemblies
---
1| author_and_software_defined_assembly
2| author_and_software_defined_assembly
Associated 3dh0 chain A to 3DH0_A with 0 mismatches
Associated 3dh0 chain B to 3DH0_A with 0 mismatches
> matchmaker #2/A to #1/A
Parameters
---
Chain pairing | bb
Alignment algorithm | Needleman-Wunsch
Similarity matrix | BLOSUM-62
SS fraction | 0.3
Gap open (HH/SS/other) | 18/18/6
Gap extend | 1
SS matrix | | | H | S | O
---|---|---|---
H | 6 | -9 | -6
S | | 6 | -6
O | | | 4
Iteration cutoff | 2
Matchmaker RRS61_with_UQplaceholder.pdb, chain A (#1) with 3DH0_A, chain A
(#2), sequence alignment score = 293.4
RMSD between 97 pruned atom pairs is 1.168 angstroms; (across all 180 pairs:
5.419)
> open O67440 fromDatabase uniprot associate #2/A,B
Summary of feedback from opening O67440 fetched from uniprot
---
notes | Fetching compressed O67440 UniProt info from https://www.uniprot.org/uniprot/O67440.xml
Alignment identifier is O67440
Associated 3DH0_A chain A to O67440 with 2 mismatches
Associated 3DH0_A chain B to O67440 with 2 mismatches
Opened UniProt O67440
> select #2/A-B:36-145
1778 atoms, 1820 bonds, 220 residues, 1 model selected
> select #2/A-B:36-145
1778 atoms, 1820 bonds, 220 residues, 1 model selected
> ~select
Nothing selected
> select #2/A-B:6,20,69,97,115
88 atoms, 78 bonds, 10 residues, 1 model selected
> select #2/A-B:36-145
1778 atoms, 1820 bonds, 220 residues, 1 model selected
> select #2/A-B:6,20,69,97,115
88 atoms, 78 bonds, 10 residues, 1 model selected
> select #2/A-B:6,20,69,97,115
88 atoms, 78 bonds, 10 residues, 1 model selected
> open pdb:6UAK
Summary of feedback from opening 6UAK fetched from pdb
---
warning | Atom OE2 has no neighbors to form bonds with according to residue template for GLU /A:251
6uak title:
LahSb - C-terminal methyltransferase involved in RiPP biosynthesis [more
info...]
Chain information for 6uak #3
---
Chain | Description | UniProt
A | SAM dependent methyltransferase LahSB | A0A3D0LE54_9FIRM 4-306
Non-standard residues in 6uak #3
---
SAH — S-adenosyl-L-homocysteine
6uak mmCIF Assemblies
---
1| author_and_software_defined_assembly
Associated 6uak chain A to 6UAK_A with 0 mismatches
> matchmaker #3/A to #1/A
Parameters
---
Chain pairing | bb
Alignment algorithm | Needleman-Wunsch
Similarity matrix | BLOSUM-62
SS fraction | 0.3
Gap open (HH/SS/other) | 18/18/6
Gap extend | 1
SS matrix | | | H | S | O
---|---|---|---
H | 6 | -9 | -6
S | | 6 | -6
O | | | 4
Iteration cutoff | 2
Matchmaker RRS61_with_UQplaceholder.pdb, chain A (#1) with 6UAK_A, chain A
(#3), sequence alignment score = 302.9
RMSD between 91 pruned atom pairs is 1.138 angstroms; (across all 200 pairs:
10.323)
> open A0A3D0LE54 fromDatabase uniprot associate #3/A
Summary of feedback from opening A0A3D0LE54 fetched from uniprot
---
notes | Fetching compressed A0A3D0LE54 UniProt info from https://www.uniprot.org/uniprot/A0A3D0LE54.xml
Alignment identifier is A0A3D0LE54
Associated 6UAK_A chain A to A0A3D0LE54 with 6 mismatches
Opened UniProt A0A3D0LE54
> select #3/A:40-164
954 atoms, 972 bonds, 125 residues, 1 model selected
> select #3/A:21,72,98-99,115
42 atoms, 39 bonds, 5 residues, 1 model selected
> select #2/A-B:36-145
1778 atoms, 1820 bonds, 220 residues, 1 model selected
> select #2/A-B:36-145
1778 atoms, 1820 bonds, 220 residues, 1 model selected
> ~select
Nothing selected
> select #2/A-B:6,20,69,97,115
88 atoms, 78 bonds, 10 residues, 1 model selected
> open pdb:1VL5
Summary of feedback from opening 1VL5 fetched from pdb
---
warning | Atom O has no neighbors to form bonds with according to residue template for GLU /A:100
1vl5 title:
Crystal structure of A putative methyltransferase (BH2331) from bacillus
halodurans C-125 At 1.95 A resolution [more info...]
Chain information for 1vl5 #4
---
Chain | Description | UniProt
A B C D | unknown conserved protein BH2331 | Q9KAF6_BACHD 19-265
1vl5 mmCIF Assemblies
---
1| author_defined_assembly
2| author_defined_assembly
3| author_defined_assembly
4| author_defined_assembly
16 atoms have alternate locations. Control/examine alternate locations with
Altloc Explorer [start tool...] or the altlocs command.
Associated 1vl5 chain A to 1VL5_A with 1 mismatch
Associated 1vl5 chain B to 1VL5_A with 1 mismatch
Associated 1vl5 chain C to 1VL5_A with 1 mismatch
Associated 1vl5 chain D to 1VL5_A with 1 mismatch
> matchmaker #4/A to #1/A
Parameters
---
Chain pairing | bb
Alignment algorithm | Needleman-Wunsch
Similarity matrix | BLOSUM-62
SS fraction | 0.3
Gap open (HH/SS/other) | 18/18/6
Gap extend | 1
SS matrix | | | H | S | O
---|---|---|---
H | 6 | -9 | -6
S | | 6 | -6
O | | | 4
Iteration cutoff | 2
Matchmaker RRS61_with_UQplaceholder.pdb, chain A (#1) with 1VL5_A, chain A
(#4), sequence alignment score = 287.3
RMSD between 116 pruned atom pairs is 1.053 angstroms; (across all 173 pairs:
7.330)
> select #4/A,B,C,D:19-265
7186 atoms, 7361 bonds, 2 pseudobonds, 906 residues, 2 models selected
> open Q9KAF6 fromDatabase uniprot associate #4/A,B,C,D
Summary of feedback from opening Q9KAF6 fetched from uniprot
---
notes | Fetching compressed Q9KAF6 UniProt info from https://www.uniprot.org/uniprot/Q9KAF6.xml
Alignment identifier is Q9KAF6
Associated 1VL5_A chain A to Q9KAF6 with 14 mismatches
Associated 1VL5_A chain B to Q9KAF6 with 14 mismatches
Associated 1VL5_A chain C to Q9KAF6 with 14 mismatches
Associated 1VL5_A chain D to Q9KAF6 with 14 mismatches
Opened UniProt Q9KAF6
> select #4/A-D:47-142
2757 atoms, 2824 bonds, 2 pseudobonds, 366 residues, 2 models selected
> select #4/A-D:47-142
2757 atoms, 2824 bonds, 2 pseudobonds, 366 residues, 2 models selected
> ui tool show "Show Sequence Viewer"
> sequence chain #2/A #2/B
Alignment identifier is 1
> sequence chain #3/A
Alignment identifier is 3/A
> sequence chain #4/A #4/B #4/C #4/D
Alignment identifier is 2
> sequence chain #1/A #1/B #1/C
Alignment identifier is 3
> open pdb:3MGG
3mgg title:
Crystal Structure of Methyl Transferase from Methanosarcina mazei [more
info...]
Chain information for 3mgg #5
---
Chain | Description | UniProt
A B | Methyltransferase | Q8PVL4_METMA 2-266
Associated 3mgg chain A to 3MGG_A with 0 mismatches
Associated 3mgg chain B to 3MGG_A with 0 mismatches
> matchmaker #5/A to #1/A
Parameters
---
Chain pairing | bb
Alignment algorithm | Needleman-Wunsch
Similarity matrix | BLOSUM-62
SS fraction | 0.3
Gap open (HH/SS/other) | 18/18/6
Gap extend | 1
SS matrix | | | H | S | O
---|---|---|---
H | 6 | -9 | -6
S | | 6 | -6
O | | | 4
Iteration cutoff | 2
Matchmaker RRS61_with_UQplaceholder.pdb, chain A (#1) with 3MGG_A, chain A
(#5), sequence alignment score = 255.6
RMSD between 91 pruned atom pairs is 1.126 angstroms; (across all 172 pairs:
8.307)
> open Q8PVL4 fromDatabase uniprot associate #5/A,B
Summary of feedback from opening Q8PVL4 fetched from uniprot
---
notes | Fetching compressed Q8PVL4 UniProt info from https://www.uniprot.org/uniprot/Q8PVL4.xml
Alignment identifier is Q8PVL4
Associated 3MGG_A chain A to Q8PVL4 with 1 mismatch
Associated 3MGG_A chain B to Q8PVL4 with 1 mismatch
Opened UniProt Q8PVL4
> select #5/A-B:36-142
1624 atoms, 1648 bonds, 214 residues, 1 model selected
> select #5/A-B:36-142
1624 atoms, 1648 bonds, 214 residues, 1 model selected
> sequence header bp1 [1] rmsd show
Should be one of 'consensus', 'conservation', or 'rmsd'
> sequence header bp1 [1] consensus show
Should be one of 'consensus', 'conservation', or 'rmsd'
> sequence header bp1 [1] consensus show
Should be one of 'consensus', 'conservation', or 'rmsd'
> hide #5 models
> hide #!4 models
> hide #!3 models
> hide #2 models
> show #2 models
> select ::name="UQ8"
318 atoms, 318 bonds, 6 residues, 1 model selected
> show sel atoms
> color sel red
> select clear
> save "C:/Users/USER/OneDrive - The Hong Kong Polytechnic University/Lab
> Documents/Log book/Log Ubi/Analysis/ChimeraX_BLAST&align/UbiE.cxs"
——— End of log from Tue Jul 30 16:37:05 2024 ———
opened ChimeraX session
> close #2,5#3-4
> ui tool show "Blast Protein"
> blastprotein /D database pdb cutoff 1e-3 matrix BLOSUM62 maxSeqs 100 version
> None name bp2
Webservices job id: UTI21X9CTTF751Y5
BlastProtein failed: 'bytes' object has no attribute 'items'
Parsing BlastProtein results failed: 'NoneType' object has no attribute 'keys'
> open help:user/tools/blastprotein.html
Opened help:user/tools/blastprotein.html
> ui tool show "Show Sequence Viewer"
> sequence chain /D
Alignment identifier is 1/D
> blastprotein 1/D:1 database pdb cutoff 1e-3 matrix BLOSUM62 maxSeqs 100
> version None name bp3
Webservices job id: H26KJ8MO4HEYGYQN
BlastProtein failed: 'bytes' object has no attribute 'items'
Parsing BlastProtein results failed: 'NoneType' object has no attribute 'keys'
> blastprotein 1/D:1 database pdb cutoff 1e-3 matrix BLOSUM62 maxSeqs 100
> version None name bp4
Missing or invalid "atoms" argument: Expected an atom specifier, [alignment-
id:]sequence-name-or-number, or sequence
> blastprotein /D database uniref100 cutoff 1e-3 matrix BLOSUM62 maxSeqs 100
> version 1 name bp5
Webservices job id: K2U0629YH8NAFA8B
BlastProtein failed: 'bytes' object has no attribute 'items'
Parsing BlastProtein results failed: 'NoneType' object has no attribute 'keys'
> select clear
[Repeated 1 time(s)]
> select /A:33 /B:33 /C:33
15 atoms, 12 bonds, 3 residues, 1 model selected
> select /A-C:32-33
36 atoms, 33 bonds, 6 residues, 1 model selected
> select /A-C:32-33
36 atoms, 33 bonds, 6 residues, 1 model selected
> blastprotein /D database uniref100 cutoff 1e-3 matrix BLOSUM62 maxSeqs 100
> version 1 name bp6
Webservices job id: OWMNR9INEU9SDEJ6
BlastProtein failed: 'bytes' object has no attribute 'items'
Parsing BlastProtein results failed: 'NoneType' object has no attribute 'keys'
> blastprotein /D database pdb cutoff 1e-3 matrix BLOSUM62 maxSeqs 100 version
> 1 name bp7
Webservices job id: 8ITWQKBU2VA22KGD
BlastProtein failed: 'bytes' object has no attribute 'items'
Parsing BlastProtein results failed: 'NoneType' object has no attribute 'keys'
>
Unknown command: sequence #1/D
> ui tool show "Show Sequence Viewer"
> sequence chain /D
Alignment identifier is 1/D
> select /D:1
8 atoms, 7 bonds, 1 residue, 1 model selected
> select /D
3026 atoms, 3100 bonds, 391 residues, 1 model selected
> blastprotein
> MTNQPTEIAIVGGGMVGGALALGLAQHGFAVTVIEHAEPAPFVADSQPDVRISAISAASVSLLKGLGVWDAVQAMRCHPYRRLETWEWETAHVVFDAAELKLPLLGYMVENTVLQQALWQALEAHPKVTLRVPGSLIALHRHDDLQELELKGGEVIRAKLVIGADGANSQVRQMAGIGVHAWQYAQSCMLISVQCENDPGDSTWQQFTPDGPRAFLPLFDNWASLVWYDSPARIRQLQNMNMAQLQAEIAKHFPSRLGYVTPLAAGAFPLTRRHALQYVQPGLALVGDAAHTIHPLAGQGVNLGYRDVDALIDVLVNARSYGEAWASYPVLKRYQMRRMADNFIMQSGMDLFYAGFSNNLPPLRFMRNLGLMAAERAGVLKRQALKYALGL
> database pdb cutoff 1e-3 matrix BLOSUM62 maxSeqs 100 version 1 name bp8
Webservices job id: W8PDOV0I49IE5VH0
BlastProtein failed: 'bytes' object has no attribute 'items'
Parsing BlastProtein results failed: 'NoneType' object has no attribute 'keys'
> blastprotein
> MTNQPTEIAIVGGGMVGGALALGLAQHGFAVTVIEHAEPAPFVADSQPDVRISAISAASVSLLKGLGVWDAVQAMRCHPYRRLETWEWETAHVVFDAAELKLPLLGYMVENTVLQQALWQALEAHPKVTLRVPGSLIALHRHDDLQELELKGGEVIRAKLVIGADGANSQVRQMAGIGVHAWQYAQSCMLISVQCENDPGDSTWQQFTPDGPRAFLPLFDNWASLVWYDSPARIRQLQNMNMAQLQAEIAKHFPSRLGYVTPLAAGAFPLTRRHALQYVQPGLALVGDAAHTIHPLAGQGVNLGYRDVDALIDVLVNARSYGEAWASYPVLKRYQMRRMADNFIMQSGMDLFYAGFSNNLPPLRFMRNLGLMAAERAGVLKRQALKYALGL
> database pdb cutoff 1e-3 matrix BLOSUM62 maxSeqs 100 version 1 name bp9
Webservices job id: 76OC7V2TA2BC9ONW
BlastProtein failed: 'bytes' object has no attribute 'items'
Parsing BlastProtein results failed: 'NoneType' object has no attribute 'keys'
OpenGL version: 3.3.0 - Build 31.0.101.5333
OpenGL renderer: Intel(R) Iris(R) Xe Graphics
OpenGL vendor: Intel
Python: 3.11.4
Locale: en_HK.cp1252
Qt version: PyQt6 6.6.1, Qt 6.6.1
Qt runtime version: 6.6.3
Qt platform: windows
Manufacturer: LENOVO
Model: 82XF
OS: Microsoft Windows 11 Home (Build 22631)
Memory: 16,890,322,944
MaxProcessMemory: 137,438,953,344
CPU: 20 13th Gen Intel(R) Core(TM) i7-13700H
OSLanguage: en-US
Installed Packages:
alabaster: 0.7.16
appdirs: 1.4.4
asttokens: 2.4.1
Babel: 2.15.0
beautifulsoup4: 4.12.3
blockdiag: 3.0.0
blosc2: 2.0.0
build: 1.2.1
certifi: 2024.6.2
cftime: 1.6.4
charset-normalizer: 3.3.2
ChimeraX-AddCharge: 1.5.17
ChimeraX-AddH: 2.2.6
ChimeraX-AlignmentAlgorithms: 2.0.2
ChimeraX-AlignmentHdrs: 3.5
ChimeraX-AlignmentMatrices: 2.1
ChimeraX-Alignments: 2.12.7
ChimeraX-AlphaFold: 1.0
ChimeraX-AltlocExplorer: 1.1.1
ChimeraX-AmberInfo: 1.0
ChimeraX-Arrays: 1.1
ChimeraX-Atomic: 1.57.1
ChimeraX-AtomicLibrary: 14.0.6
ChimeraX-AtomSearch: 2.0.1
ChimeraX-AxesPlanes: 2.4
ChimeraX-BasicActions: 1.1.2
ChimeraX-BILD: 1.0
ChimeraX-BlastProtein: 2.4.6
ChimeraX-BondRot: 2.0.4
ChimeraX-BugReporter: 1.0.1
ChimeraX-BuildStructure: 2.12.1
ChimeraX-Bumps: 1.0
ChimeraX-BundleBuilder: 1.2.7
ChimeraX-ButtonPanel: 1.0.1
ChimeraX-CageBuilder: 1.0.1
ChimeraX-CellPack: 1.0
ChimeraX-Centroids: 1.4
ChimeraX-ChangeChains: 1.1
ChimeraX-CheckWaters: 1.4
ChimeraX-ChemGroup: 2.0.1
ChimeraX-Clashes: 2.2.4
ChimeraX-ColorActions: 1.0.5
ChimeraX-ColorGlobe: 1.0
ChimeraX-ColorKey: 1.5.6
ChimeraX-CommandLine: 1.2.5
ChimeraX-ConnectStructure: 2.0.1
ChimeraX-Contacts: 1.0.1
ChimeraX-Core: 1.8
ChimeraX-CoreFormats: 1.2
ChimeraX-coulombic: 1.4.3
ChimeraX-Crosslinks: 1.0
ChimeraX-Crystal: 1.0
ChimeraX-CrystalContacts: 1.0.1
ChimeraX-DataFormats: 1.2.3
ChimeraX-Dicom: 1.2.4
ChimeraX-DiffPlot: 1.0
ChimeraX-DistMonitor: 1.4.2
ChimeraX-DockPrep: 1.1.3
ChimeraX-Dssp: 2.0
ChimeraX-EMDB-SFF: 1.0
ChimeraX-ESMFold: 1.0
ChimeraX-FileHistory: 1.0.1
ChimeraX-FunctionKey: 1.0.1
ChimeraX-Geometry: 1.3
ChimeraX-gltf: 1.0
ChimeraX-Graphics: 1.1.1
ChimeraX-Hbonds: 2.4
ChimeraX-Help: 1.2.2
ChimeraX-HKCage: 1.3
ChimeraX-IHM: 1.1
ChimeraX-ImageFormats: 1.2
ChimeraX-IMOD: 1.0
ChimeraX-IO: 1.0.1
ChimeraX-ItemsInspection: 1.0.1
ChimeraX-IUPAC: 1.0
ChimeraX-Label: 1.1.10
ChimeraX-ListInfo: 1.2.2
ChimeraX-Log: 1.1.6
ChimeraX-LookingGlass: 1.1
ChimeraX-Maestro: 1.9.1
ChimeraX-Map: 1.2
ChimeraX-MapData: 2.0
ChimeraX-MapEraser: 1.0.1
ChimeraX-MapFilter: 2.0.1
ChimeraX-MapFit: 2.0
ChimeraX-MapSeries: 2.1.1
ChimeraX-Markers: 1.0.1
ChimeraX-Mask: 1.0.2
ChimeraX-MatchMaker: 2.1.3
ChimeraX-MCopy: 1.0
ChimeraX-MDcrds: 2.7.1
ChimeraX-MedicalToolbar: 1.0.3
ChimeraX-Meeting: 1.0.1
ChimeraX-MLP: 1.1.1
ChimeraX-mmCIF: 2.14.1
ChimeraX-MMTF: 2.2
ChimeraX-Modeller: 1.5.17
ChimeraX-ModelPanel: 1.5
ChimeraX-ModelSeries: 1.0.1
ChimeraX-Mol2: 2.0.3
ChimeraX-Mole: 1.0
ChimeraX-Morph: 1.0.2
ChimeraX-MouseModes: 1.2
ChimeraX-Movie: 1.0
ChimeraX-Neuron: 1.0
ChimeraX-Nifti: 1.2
ChimeraX-NMRSTAR: 1.0.2
ChimeraX-NRRD: 1.2
ChimeraX-Nucleotides: 2.0.3
ChimeraX-OpenCommand: 1.13.5
ChimeraX-PDB: 2.7.5
ChimeraX-PDBBio: 1.0.1
ChimeraX-PDBLibrary: 1.0.4
ChimeraX-PDBMatrices: 1.0
ChimeraX-PickBlobs: 1.0.1
ChimeraX-Positions: 1.0
ChimeraX-PresetMgr: 1.1.1
ChimeraX-PubChem: 2.2
ChimeraX-ReadPbonds: 1.0.1
ChimeraX-Registration: 1.1.2
ChimeraX-RemoteControl: 1.0
ChimeraX-RenderByAttr: 1.4.1
ChimeraX-RenumberResidues: 1.1
ChimeraX-ResidueFit: 1.0.1
ChimeraX-RestServer: 1.2
ChimeraX-RNALayout: 1.0
ChimeraX-RotamerLibMgr: 4.0
ChimeraX-RotamerLibsDunbrack: 2.0
ChimeraX-RotamerLibsDynameomics: 2.0
ChimeraX-RotamerLibsRichardson: 2.0
ChimeraX-SaveCommand: 1.5.1
ChimeraX-SchemeMgr: 1.0
ChimeraX-SDF: 2.0.2
ChimeraX-Segger: 1.0
ChimeraX-Segment: 1.0.1
ChimeraX-Segmentations: 3.0.15
ChimeraX-SelInspector: 1.0
ChimeraX-SeqView: 2.11.2
ChimeraX-Shape: 1.0.1
ChimeraX-Shell: 1.0.1
ChimeraX-Shortcuts: 1.1.1
ChimeraX-ShowSequences: 1.0.3
ChimeraX-SideView: 1.0.1
ChimeraX-Smiles: 2.1.2
ChimeraX-SmoothLines: 1.0
ChimeraX-SpaceNavigator: 1.0
ChimeraX-StdCommands: 1.16.5
ChimeraX-STL: 1.0.1
ChimeraX-Storm: 1.0
ChimeraX-StructMeasure: 1.2.1
ChimeraX-Struts: 1.0.1
ChimeraX-Surface: 1.0.1
ChimeraX-SwapAA: 2.0.1
ChimeraX-SwapRes: 2.5
ChimeraX-TapeMeasure: 1.0
ChimeraX-TaskManager: 1.0
ChimeraX-Test: 1.0
ChimeraX-Toolbar: 1.1.2
ChimeraX-ToolshedUtils: 1.2.4
ChimeraX-Topography: 1.0
ChimeraX-ToQuest: 1.0
ChimeraX-Tug: 1.0.1
ChimeraX-UI: 1.39.1
ChimeraX-uniprot: 2.3
ChimeraX-UnitCell: 1.0.1
ChimeraX-ViewDockX: 1.4.3
ChimeraX-VIPERdb: 1.0
ChimeraX-Vive: 1.1
ChimeraX-VolumeMenu: 1.0.1
ChimeraX-vrml: 1.0
ChimeraX-VTK: 1.0
ChimeraX-WavefrontOBJ: 1.0
ChimeraX-WebCam: 1.0.2
ChimeraX-WebServices: 1.1.4
ChimeraX-Zone: 1.0.1
colorama: 0.4.6
comm: 0.2.2
comtypes: 1.4.1
contourpy: 1.2.1
cxservices: 1.2.2
cycler: 0.12.1
Cython: 3.0.10
debugpy: 1.8.1
decorator: 5.1.1
docutils: 0.20.1
executing: 2.0.1
filelock: 3.13.4
fonttools: 4.53.0
funcparserlib: 2.0.0a0
glfw: 2.7.0
grako: 3.16.5
h5py: 3.11.0
html2text: 2024.2.26
idna: 3.7
ihm: 1.0
imagecodecs: 2024.1.1
imagesize: 1.4.1
ipykernel: 6.29.2
ipython: 8.21.0
ipywidgets: 8.1.3
jedi: 0.19.1
jinja2: 3.1.4
jupyter-client: 8.6.0
jupyter-core: 5.7.2
jupyterlab-widgets: 3.0.11
kiwisolver: 1.4.5
line-profiler: 4.1.2
lxml: 5.2.1
lz4: 4.3.3
MarkupSafe: 2.1.5
matplotlib: 3.8.4
matplotlib-inline: 0.1.7
msgpack: 1.0.8
nest-asyncio: 1.6.0
netCDF4: 1.6.5
networkx: 3.3
nibabel: 5.2.0
nptyping: 2.5.0
numexpr: 2.10.0
numpy: 1.26.4
openvr: 1.26.701
packaging: 24.1
ParmEd: 4.2.2
parso: 0.8.4
pep517: 0.13.1
pillow: 10.3.0
pip: 24.0
pkginfo: 1.10.0
platformdirs: 4.2.2
prompt-toolkit: 3.0.47
psutil: 5.9.8
pure-eval: 0.2.2
py-cpuinfo: 9.0.0
pycollada: 0.8
pydicom: 2.4.4
pygments: 2.17.2
pynmrstar: 3.3.4
pynrrd: 1.0.0
PyOpenGL: 3.1.7
PyOpenGL-accelerate: 3.1.7
pyopenxr: 1.0.3401
pyparsing: 3.1.2
pyproject-hooks: 1.1.0
PyQt6-commercial: 6.6.1
PyQt6-Qt6: 6.6.3
PyQt6-sip: 13.6.0
PyQt6-WebEngine-commercial: 6.6.0
PyQt6-WebEngine-Qt6: 6.6.3
python-dateutil: 2.9.0.post0
pytz: 2024.1
pywin32: 306
pyzmq: 26.0.3
qtconsole: 5.5.1
QtPy: 2.4.1
RandomWords: 0.4.0
requests: 2.31.0
scipy: 1.13.0
setuptools: 69.5.1
sfftk-rw: 0.8.1
six: 1.16.0
snowballstemmer: 2.2.0
sortedcontainers: 2.4.0
soupsieve: 2.5
sphinx: 7.2.6
sphinx-autodoc-typehints: 2.0.1
sphinxcontrib-applehelp: 1.0.8
sphinxcontrib-blockdiag: 3.0.0
sphinxcontrib-devhelp: 1.0.6
sphinxcontrib-htmlhelp: 2.0.5
sphinxcontrib-jsmath: 1.0.1
sphinxcontrib-qthelp: 1.0.7
sphinxcontrib-serializinghtml: 1.1.10
stack-data: 0.6.3
superqt: 0.6.3
tables: 3.8.0
tcia-utils: 1.5.1
tifffile: 2024.1.30
tinyarray: 1.2.4
tornado: 6.4.1
traitlets: 5.14.2
typing-extensions: 4.12.2
tzdata: 2024.1
urllib3: 2.2.1
wcwidth: 0.2.13
webcolors: 1.13
wheel: 0.43.0
wheel-filename: 1.4.1
widgetsnbextension: 4.0.11
WMI: 1.5.1
Change History (7)
comment:1 by , 22 months ago
| Cc: | added |
|---|---|
| Owner: | set to |
| Platform: | → all |
| Project: | → ChimeraX |
| Status: | new → assigned |
comment:2 by , 22 months ago
Traceback from a job I just ran:
{
"event": "[Job 5EYRG99NPJ7Q7TEP]: exception raised while executing (cxservices.task_runners.blast.run_job)\nTraceback (most recent call last):\n File \"/usr/local/www/webservices/wsgi-scripts/cxservices/.venv/lib64/python3.8/site-packages/rq/worker.py\", line 1418, in perform_job\n rv = job.perform()\n File \"/usr/local/www/webservices/wsgi-scripts/cxservices/cxservices/worker.py\", line 39, in perform\n result = super().perform()\n File \"/usr/local/www/webservices/wsgi-scripts/cxservices/.venv/lib64/python3.8/site-packages/rq/job.py\", line 1225, in perform\n self._result = self._execute()\n File \"/usr/local/www/webservices/wsgi-scripts/cxservices/.venv/lib64/python3.8/site-packages/rq/job.py\", line 1262, in _execute\n result = self.func(*self.args, **self.kwargs)\n File \"/usr/local/www/webservices/wsgi-scripts/cxservices/task_runners/blast.py\", line 75, in run_job\n raise RuntimeError(job.stderr.decode(\"utf-8\"))\nRuntimeError: BLAST Database error: No alias or index file found for protein database [/databases/mol/AlphaFold/v2/alphafold.fasta] in search path [/var/lib/pacemaker/cores::]\n\n",
"level": "error",
"timestamp": "2024-07-31T17:34:31.340309Z"
}
comment:3 by , 22 months ago
| Summary: | ChimeraX bug report submission → BLAST databases missing |
|---|
In webservices we set the paths to the database prefixes as follows:
AlphaFoldDir = "/databases/mol/AlphaFold/v" StdDbDir = "/databases/mol/blast/db_current" UniRefDir = "/databases/mol/blast/db_uniref" EsmfoldDir = "/databases/mol/ESMFold/v"
The AlphaFold and ESMFold directories are missing from /databases/mol/ and it looks to me like /databases/mol/blast/db_current is empty.
comment:4 by , 22 months ago
I think you may have caught us during a database update; I will close this ticket when it completes and we will announce these in the future.
comment:5 by , 22 months ago
| Cc: | added |
|---|---|
| Component: | Unassigned → Web Services |
comment:6 by , 22 months ago
The BLAST databases were accidentally deleted. I restored the AlphaFold BLAST database from a backup. The PDB BLAST database and NR were recreated. The Uniref BLAST databases are still gone and Scooter said he is working on writing scripts to update those.
comment:7 by , 20 months ago
| Resolution: | → fixed |
|---|---|
| Status: | assigned → closed |
This has been fixed for a while.
PCS status on our server shows many service failures. We have scheduled downtime, but my email says it's tomorrow.