Opened 3 years ago

Closed 2 years ago

#10225 closed defect (limitation)

Restore new session in old ChimeraX

Reported by: chimerax-bug-report@… Owned by: Eric Pettersen
Priority: normal Milestone:
Component: Sessions Version:
Keywords: Cc:
Blocked By: Blocking:
Notify when closed: Platform: all
Project: ChimeraX

Description

The following bug report has been submitted:
Platform:        Windows-10-10.0.22621
ChimeraX Version: 1.6.1 (2023-05-09 17:57:07 UTC)
Description
(Describe the actions that caused this problem to occur here)

Log:
UCSF ChimeraX version: 1.6.1 (2023-05-09)  
© 2016-2023 Regents of the University of California. All rights reserved.  

> open "C:\Users\shard\Downloads\ChimeraX\N-ALFA_SPPL2a_ALFA-nanobody PDB
> based.cxs" format session

Log from Wed Oct 4 17:39:54 2023UCSF ChimeraX version: 1.7.dev202310030223
(2023-10-03)  
© 2016-2023 Regents of the University of California. All rights reserved.  

> open F:\Shardul\N-ALFA_SPPL2a_ALFA-nanobody.cxs format session

Log from Wed Oct 4 16:17:20 2023 Startup Messages  
---  
note | available bundle cache has not been initialized yet  
  
UCSF ChimeraX version: 1.7.dev202310030223 (2023-10-03)  
© 2016-2023 Regents of the University of California. All rights reserved.  
How to cite UCSF ChimeraX  

> ui tool show AlphaFold

> alphafold predict
> MPSRLEEELRRRLTEPQEAILHASGNGTTKDYCMLYNPYWTALPSTLENATSISLMNLTSTPLCNLSDIPPVGIKSKAVVVPWGSCHFLEKARIAQKGGAEAMLVVNNSVLFPPSGNRSEFPDVKILIAFISYKDFRDMNQTLGDNITVKMYSPSWPNFDYTMVVIFVIAVFTVALGGYWSGLVELENLKAVTTEDREMRKKKEEYLTFSPLTVVIFVVICCVMMVLLYFFYKWLVYVMIAIFCIASAMSLYNCLAALIHKIPYGQCTIACRGKNMEVRLIFLSGLCIAVAVVWAVFRNEDRWAWILQDILGIAFCLNLIKTLKLPNFKSCVILLGLLLLYDVFFVFITPFITKNGESIMVELAAGPFGNNEKLPVVIRVPKLIYFSVMSVCLMPVSILGFGDIIVPGLLIAYCRRFDVQTGSSYIYYVSSTVAYAIGMILTFVVLVLMKKGQPALLYLVPCTLITASVVAWRRKEMKKFWKGNSYQMMDHLDCATNEENPVISGEQIVQQ,MSGEVQLQESGGGLVQPGGSLRLSCTASGVTISALNAMAMGWYRQAPGERRVMVAAVSERGNAMYRESVQGRFTVTRDFTNKMVSLQMDNLKPEDTAVYYCHVLEDRVDSFHDYWGQGTQVTVSSLEHHHHHH

Please cite ColabFold: Making protein folding accessible to all. Nature
Methods (2022) if you use these predictions.  
Running AlphaFold prediction  

> alphafold predict
> MPSRLEEELRRRLTEPQEAILHASGNGTTKDYCMLYNPYWTALPSTLENATSISLMNLTSTPLCNLSDIPPVGIKSKAVVVPWGSCHFLEKARIAQKGGAEAMLVVNNSVLFPPSGNRSEFPDVKILIAFISYKDFRDMNQTLGDNITVKMYSPSWPNFDYTMVVIFVIAVFTVALGGYWSGLVELENLKAVTTEDREMRKKKEEYLTFSPLTVVIFVVICCVMMVLLYFFYKWLVYVMIAIFCIASAMSLYNCLAALIHKIPYGQCTIACRGKNMEVRLIFLSGLCIAVAVVWAVFRNEDRWAWILQDILGIAFCLNLIKTLKLPNFKSCVILLGLLLLYDVFFVFITPFITKNGESIMVELAAGPFGNNEKLPVVIRVPKLIYFSVMSVCLMPVSILGFGDIIVPGLLIAYCRRFDVQTGSSYIYYVSSTVAYAIGMILTFVVLVLMKKGQPALLYLVPCTLITASVVAWRRKEMKKFWKGNSYQMMDHLDCATNEENPVISGEQIVQQ,MSGEVQLQESGGGLVQPGGSLRLSCTASGVTISALNAMAMGWYRQAPGERRVMVAAVSERGNAMYRESVQGRFTVTRDFTNKMVSLQMDNLKPEDTAVYYCHVLEDRVDSFHDYWGQGTQVTVSSLEHHHHHH

Running AlphaFold prediction  
AlphaFold prediction finished  
Results in C:\Users\akta-pure-rt/Downloads/ChimeraX/AlphaFold/prediction_2  

> open C:\Users\akta-pure-
> rt/Downloads/ChimeraX/AlphaFold/prediction_2\best_model.pdb

Chain information for best_model.pdb #1  
---  
Chain | Description  
A | No description available  
B | No description available  
  

> save F:/Shardul/N-ALFA_SPPL2a_ALFA-nanobody.cxs

——— End of log from Wed Oct 4 16:17:20 2023 ———

opened ChimeraX session  

> close

> ui tool show AlphaFold

> alphafold predict
> MPSRLEEELRRRLTEPQEAILHASGNGTTKDYCMLYNPYWTALPSTLENATSISLMNLTSTPLCNLSDIPPVGIKSKAVVVPWGSCHFLEKARIAQKGGAEAMLVVNNSVLFPPSGNRSEFPDVKILIAFISYKDFRDMNQTLGDNITVKMYSPSWPNFDYTMVVIFVIAVFTVALGGYWSGLVELENLKAVTTEDREMRKKKEEYLTFSPLTVVIFVVICCVMMVLLYFFYKWLVYVMIAIFCIASAMSLYNCLAALIHKIPYGQCTIACRGKNMEVRLIFLSGLCIAVAVVWAVFRNEDRWAWILQDILGIAFCLNLIKTLKLPNFKSCVILLGLLLLYDVFFVFITPFITKNGESIMVELAAGPFGNNEKLPVVIRVPKLIYFSVMSVCLMPVSILGFGDIIVPGLLIAYCRRFDVQTGSSYIYYVSSTVAYAIGMILTFVVLVLMKKGQPALLYLVPCTLITASVVAWRRKEMKKFWKGNSYQMMDHLDCATNEENPVISGEQIVQQ,MSGEVQLQESGGGLVQPGGSLRLSCTASGVTISALNAMAMGWYRQAPGERRVMVAAVSERGNAMYRESVQGRFTVTRDFTNKMVSLQMDNLKPEDTAVYYCHVLEDRVDSFHDYWGQGTQVTVSSLEHHHHHH
> templates true

Please cite ColabFold: Making protein folding accessible to all. Nature
Methods (2022) if you use these predictions.  
Running AlphaFold prediction  

> alphafold predict
> MPSRLEEELRRRLTEPQEAILHASGNGTTKDYCMLYNPYWTALPSTLENATSISLMNLTSTPLCNLSDIPPVGIKSKAVVVPWGSCHFLEKARIAQKGGAEAMLVVNNSVLFPPSGNRSEFPDVKILIAFISYKDFRDMNQTLGDNITVKMYSPSWPNFDYTMVVIFVIAVFTVALGGYWSGLVELENLKAVTTEDREMRKKKEEYLTFSPLTVVIFVVICCVMMVLLYFFYKWLVYVMIAIFCIASAMSLYNCLAALIHKIPYGQCTIACRGKNMEVRLIFLSGLCIAVAVVWAVFRNEDRWAWILQDILGIAFCLNLIKTLKLPNFKSCVILLGLLLLYDVFFVFITPFITKNGESIMVELAAGPFGNNEKLPVVIRVPKLIYFSVMSVCLMPVSILGFGDIIVPGLLIAYCRRFDVQTGSSYIYYVSSTVAYAIGMILTFVVLVLMKKGQPALLYLVPCTLITASVVAWRRKEMKKFWKGNSYQMMDHLDCATNEENPVISGEQIVQQ,MSGEVQLQESGGGLVQPGGSLRLSCTASGVTISALNAMAMGWYRQAPGERRVMVAAVSERGNAMYRESVQGRFTVTRDFTNKMVSLQMDNLKPEDTAVYYCHVLEDRVDSFHDYWGQGTQVTVSSLEHHHHHH
> templates true

Running AlphaFold prediction  
AlphaFold prediction finished  
Results in C:\Users\akta-pure-rt/Downloads/ChimeraX/AlphaFold/prediction_3  

> open C:\Users\akta-pure-
> rt/Downloads/ChimeraX/AlphaFold/prediction_3\best_model.pdb

Chain information for best_model.pdb #1  
---  
Chain | Description  
A | No description available  
B | No description available  
  

> save "F:/Shardul/N-ALFA_SPPL2a_ALFA-nanobody PDB based.cxs"

——— End of log from Wed Oct 4 17:39:54 2023 ———

opened ChimeraX session  

> close

> open C:/Users/shard/Downloads/ChimeraX/N-ALFA_SPPL2a_Nb_3EAAAK.cxs

Unable to restore session, resetting.  
  
Traceback (most recent call last):  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 700, in restore  
self.reset()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 541, in reset  
sm.reset_state(container, self)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 149, in reset_state  
self.clear()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 45, in delete_all_rotations  
for rotater in self.bond_rotaters.values():  
AttributeError: 'list' object has no attribute 'values'  
  
Traceback (most recent call last):  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 700, in restore  
self.reset()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 541, in reset  
sm.reset_state(container, self)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 149, in reset_state  
self.clear()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 45, in delete_all_rotations  
for rotater in self.bond_rotaters.values():  
AttributeError: 'list' object has no attribute 'values'  
  
During handling of the above exception, another exception occurred:  
  
Traceback (most recent call last):  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\dialog.py", line 162, in _qt_safe  
run(session, "open " + " ".join([FileNameArg.unparse(p) for p in paths]) + (""  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\commands\run.py", line 38, in run  
results = command.run(text, log=log, return_json=return_json)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\commands\cli.py", line 2897, in run  
result = ci.function(session, **kw_args)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\cmd.py", line 119, in cmd_open  
models = Command(session, registry=registry).run(provider_cmd_text,
log=log)[0]  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\commands\cli.py", line 2897, in run  
result = ci.function(session, **kw_args)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\cmd.py", line 194, in provider_open  
models, status = collated_open(session, None, [data], data_format,
_add_models,  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\cmd.py", line 465, in collated_open  
return remember_data_format()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\cmd.py", line 435, in remember_data_format  
models, status = func(*func_args, **func_kw)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core_formats\\__init__.py", line 26, in open  
return cxs_open(session, data, **kw)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 1004, in open  
session.restore(stream, path=path, resize_window=resize_window)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 742, in restore  
self.reset()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 541, in reset  
sm.reset_state(container, self)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 149, in reset_state  
self.clear()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 45, in delete_all_rotations  
for rotater in self.bond_rotaters.values():  
AttributeError: 'list' object has no attribute 'values'  
  
AttributeError: 'list' object has no attribute 'values'  
  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 45, in delete_all_rotations  
for rotater in self.bond_rotaters.values():  
  
See log for complete Python traceback.  
  

> open C:/Users/shard/Downloads/ChimeraX/AlphaFold/prediction_6/best_model.pdb

Chain information for best_model.pdb #1  
---  
Chain | Description  
A | No description available  
  

> set bgColor black

> set bgColor white

> open C:/Users/shard/Downloads/ChimeraX/AlphaFold/prediction_7/best_model.pdb

Chain information for best_model.pdb #2  
---  
Chain | Description  
A | No description available  
B | No description available  
  

> matchmaker #1 to #2

Parameters  
---  
Chain pairing | bb  
Alignment algorithm | Needleman-Wunsch  
Similarity matrix | BLOSUM-62  
SS fraction | 0.3  
Gap open (HH/SS/other) | 18/18/6  
Gap extend | 1  
SS matrix |  |  | H | S | O  
---|---|---|---  
H | 6 | -9 | -6  
S |  | 6 | -6  
O |  |  | 4  
Iteration cutoff | 2  
  
Matchmaker best_model.pdb, chain A (#2) with best_model.pdb, chain A (#1),
sequence alignment score = 150.8  
RMSD between 30 pruned atom pairs is 0.670 angstroms; (across all 32 pairs:
2.200)  
  

> hide #1 models

> hide #2 models

> show #1 models

> ui mousemode right select

Drag select of 22 residues  

> select add #1/A:23

180 atoms, 4 bonds, 23 residues, 1 model selected  

> select add #1/A:24

189 atoms, 12 bonds, 24 residues, 1 model selected  

> select add #1/A:25

198 atoms, 20 bonds, 25 residues, 1 model selected  

> select add #1/A:26

203 atoms, 24 bonds, 26 residues, 1 model selected  

> select add #1/A:27

208 atoms, 28 bonds, 27 residues, 1 model selected  

> select add #1/A:28

213 atoms, 32 bonds, 28 residues, 1 model selected  

> show #2 models

> hide #2 models

> show #2 models

> select clear

> undo

> select add #2/A:1

221 atoms, 39 bonds, 29 residues, 2 models selected  

> select up

234 atoms, 53 bonds, 31 residues, 2 models selected  

> select up

4648 atoms, 4763 bonds, 592 residues, 2 models selected  

> select down

234 atoms, 53 bonds, 31 residues, 2 models selected  

> select subtract #2/A:1

226 atoms, 45 bonds, 30 residues, 2 models selected  

> select up

234 atoms, 53 bonds, 31 residues, 2 models selected  

> select up

4648 atoms, 4763 bonds, 592 residues, 2 models selected  

> select down

234 atoms, 53 bonds, 31 residues, 2 models selected  

> select up

4648 atoms, 4763 bonds, 592 residues, 2 models selected  

> select down

234 atoms, 53 bonds, 31 residues, 2 models selected  

> select down

226 atoms, 45 bonds, 30 residues, 2 models selected  

> select down

226 atoms, 45 bonds, 30 residues, 2 models selected  

> select up

234 atoms, 53 bonds, 31 residues, 2 models selected  

> select up

4648 atoms, 4763 bonds, 592 residues, 2 models selected  

> select up

5682 atoms, 5819 bonds, 725 residues, 2 models selected  

> select down

4648 atoms, 4763 bonds, 592 residues, 2 models selected  

> show sel atoms

> hide sel atoms

> select down

234 atoms, 53 bonds, 31 residues, 2 models selected  

> show sel atoms

> hide #2 models

> show #2 models

> hide #1 models

Drag select of 13 atoms, 14 residues, 11 bonds  
Drag select of 15 residues  
Drag select of 1 residues  

> select clear

[Repeated 1 time(s)]Drag select of 12 atoms, 23 residues, 11 bonds  

> select clear

Drag select of 11 atoms, 31 residues, 10 bonds  

> select add #2/A:5

241 atoms, 17 bonds, 32 residues, 1 model selected  

> hide sel atoms

> show sel atoms

> select clear

> show #1 models

> select clear

> lighting simple

> lighting soft

> graphics silhouettes true

> lighting soft

> lighting full

> lighting flat

> lighting shadows true intensity 0.5

> lighting simple

> view orient

> ui tool show "Side View"

> select #2/B

1034 atoms, 1056 bonds, 133 residues, 1 model selected  

> ui tool show "Color Actions"

> color sel #ff0000ff

> color sel #ff5500ff

> color sel #ff557fff

> color sel #55aaffff

> color sel #ff557fff

> select #2/A

241 atoms, 243 bonds, 32 residues, 1 model selected  

> color sel #55ffffff

> color sel #00ffffff

> color sel #aaffffff

> color sel #5500ffff

> color sel #ffff00ff

> color sel #ffff7fff

> select clear

> select #1/A

4407 atoms, 4520 bonds, 560 residues, 1 model selected  

> color sel #5555ffff

> select clear

> color #5500ffff

> undo

> select #1/A

4407 atoms, 4520 bonds, 560 residues, 1 model selected  

> select clear

> hide #2 models

Drag select of 123 atoms, 26 residues, 100 bonds  

> select add #1/A:27

208 atoms, 104 bonds, 27 residues, 1 model selected  

> select add #1/A:28

213 atoms, 108 bonds, 28 residues, 1 model selected  

> select add #1/A:29

222 atoms, 116 bonds, 29 residues, 1 model selected  

> select add #1/A:30

227 atoms, 120 bonds, 30 residues, 1 model selected  

> select add #1/A:31

234 atoms, 127 bonds, 31 residues, 1 model selected  

> select add #1/A:32

241 atoms, 134 bonds, 32 residues, 1 model selected  

> color sel red

> select clear

Drag select of 12 residues  

> select clear

> undo

[Repeated 3 time(s)]

> hide sel atoms

> select clear

> lighting soft

> lighting full

> lighting shadows false

> lighting shadows true

> graphics silhouettes false

> graphics silhouettes true

> graphics silhouettes false

> lighting soft

> lighting simple

> graphics silhouettes true

> lighting simple

> lighting soft

> graphics silhouettes false

> graphics silhouettes true

> lighting soft

> lighting full

> lighting flat

> lighting shadows true intensity 0.5

> lighting shadows false

> lighting shadows true

> lighting shadows false

> lighting shadows true

> lighting shadows false

> lighting flat

> lighting full

> lighting soft

> save C:/Users/shard/Downloads/ChimeraX/N-ALFA_3EAAK_SPPL2a.png width 959
> height 596 supersample 3

[Repeated 1 time(s)]

> show #2 models

> hide #2 models

Drag select of 28 residues  

> select #1/A:11

11 atoms, 10 bonds, 1 residue, 1 model selected  
Drag select of 15 residues  

> select clear

Drag select of 3 residues  

> select clear

Drag select of 15 residues  

> select clear

Drag select of 28 residues  

> select add #1/A:29

222 atoms, 8 bonds, 29 residues, 1 model selected  

> select add #1/A:30

227 atoms, 12 bonds, 30 residues, 1 model selected  

> select add #1/A:31

234 atoms, 19 bonds, 31 residues, 1 model selected  

> select add #1/A:32

241 atoms, 26 bonds, 32 residues, 1 model selected  

> show sel atoms

> select clear

> show #2 models

> undo

[Repeated 4 time(s)]

> select clear

> show #2 models

Drag select of 462 residues, 148 atoms, 119 bonds  

> hide sel atoms

> select clear

> save "C:/Users/shard/Downloads/ChimeraX/N-ALFA_3EAAK_SPPL2a overlay with
> nanobody overlay.png" width 959 height 596 supersample 3

> hide #2 models

> show #2 models

> hide #1 models

Drag select of 32 residues  

> show sel atoms

> select clear

> hide #2 models

> show #1 models

Drag select of 14 residues  

> select clear

Drag select of 19 residues  
Drag select of 5 residues  
Drag select of 30 residues  

> select clear

Drag select of 29 residues  

> select add #1/A:30

227 atoms, 4 bonds, 30 residues, 1 model selected  

> select add #1/A:31

234 atoms, 11 bonds, 31 residues, 1 model selected  

> select add #1/A:32

241 atoms, 18 bonds, 32 residues, 1 model selected  

> show sel atoms

> select clear

> show #2 models

> undo

[Repeated 3 time(s)]

> select clear

> show #2 models

Drag select of 416 residues, 148 atoms, 119 bonds  

> hide sel atoms

> select clear

[Repeated 1 time(s)]

> save "C:/Users/shard/Downloads/ChimeraX/N-ALFA_3EAAK_SPPL2a overlay with
> nanobody overlay side view.png" width 959 height 596 supersample 3

Drag select of 79 residues  

> select clear

Drag select of 382 residues  

> select clear

Drag select of 379 residues  

> hide sel cartoons

Drag select of 88 residues  

> hide sel cartoons

Drag select of 41 residues  

> hide sel cartoons

Drag select of 7 residues  

> hide sel cartoons

Drag select of 1 residues  

> hide sel cartoons

Drag select of 8 residues  
Drag select of 12 residues  

> hide sel cartoons

> save "C:/Users/shard/Downloads/ChimeraX/3EAAK_ALFA_nanobody and ALFA
> overlay.png" width 959 height 596 supersample 3

> save "C:/Users/shard/Downloads/ChimeraX/3EAAK_ALFA_nanobody and ALFA overlay
> front view.png" width 959 height 596 supersample 3

Drag select of 64 residues  

> show sel atoms

> select clear

Drag select of 27 atoms, 22 residues, 19 bonds  
Drag select of 101 atoms, 36 residues, 75 bonds  

> select subtract #1/A:15

227 atoms, 75 bonds, 35 residues, 2 models selected  

> select subtract #2/A:15

218 atoms, 75 bonds, 34 residues, 2 models selected  

> hide sel atoms

> select clear

> undo

> show sel atoms

> hide sel atoms

> select clear

> undo

> color sel black

> select clear

> undo

[Repeated 2 time(s)]

> color sel dim gray

Drag select of 5 residues  

> select clear

[Repeated 1 time(s)]

> select #1/A:3

6 atoms, 5 bonds, 1 residue, 1 model selected  

> select #1/A:3

6 atoms, 5 bonds, 1 residue, 1 model selected  

> select #1/A:3

6 atoms, 5 bonds, 1 residue, 1 model selected  

> select #2/A:3

6 atoms, 5 bonds, 1 residue, 1 model selected  

> select #2/A:3

6 atoms, 5 bonds, 1 residue, 1 model selected  

> select #2/A:3

6 atoms, 5 bonds, 1 residue, 1 model selected  

> select #2/A:3

6 atoms, 5 bonds, 1 residue, 1 model selected  

> select clear

[Repeated 1 time(s)]

> select #2/B:109

8 atoms, 7 bonds, 1 residue, 1 model selected  

> show sel atoms

Drag select of 1 atoms, 2 bonds  

> select clear

> hide sel cartoons

> undo

> hide sel atoms

[Repeated 1 time(s)]

> select #2/B:109@CA

1 atom, 1 residue, 1 model selected  

> hide sel atoms

Drag select of 4 atoms, 3 residues, 3 bonds  

> hide sel atoms

> select clear

> select #2/B:105

9 atoms, 8 bonds, 1 residue, 1 model selected  

> show sel atoms

> hide sel atoms

> select clear

> select #2/A:6

9 atoms, 8 bonds, 1 residue, 1 model selected  

> select #2/A:6

9 atoms, 8 bonds, 1 residue, 1 model selected  

> select #2/B:59

9 atoms, 8 bonds, 1 residue, 1 model selected  

> select clear

[Repeated 2 time(s)]

> open C:/Users/shard/Downloads/ChimeraX/6i2g.pdb

6i2g.pdb title:  
ALFA-tag binding nanobody (nbalfa) bound to ALFA-tag peptide. [more info...]  
  
Chain information for 6i2g.pdb #3  
---  
Chain | Description  
A | ALFA nanobody  
B | N7P-ser-arg-leu-glu-glu-glu-leu-arg-arg-arg-leu-THR-glu- LPD  
  
Non-standard residues in 6i2g.pdb #3  
---  
LPD — L-prolinamide  
N7P — 1-acetyl-L-proline (N-acetylproline)  
SO4 — sulfate ion  
  

> hide #2 models

> matchmaker #1 to #3

Parameters  
---  
Chain pairing | bb  
Alignment algorithm | Needleman-Wunsch  
Similarity matrix | BLOSUM-62  
SS fraction | 0.3  
Gap open (HH/SS/other) | 18/18/6  
Gap extend | 1  
SS matrix |  |  | H | S | O  
---|---|---|---  
H | 6 | -9 | -6  
S |  | 6 | -6  
O |  |  | 4  
Iteration cutoff | 2  
  
Matchmaker 6i2g.pdb, chain B (#3) with best_model.pdb, chain A (#1), sequence
alignment score = 55.7  
RMSD between 13 pruned atom pairs is 0.367 angstroms; (across all 14 pairs:
1.837)  
  
Drag select of 46 atoms, 45 residues, 35 bonds  

> show sel atoms

> select clear

Drag select of 17 atoms, 7 residues, 15 bonds  
Drag select of 37 atoms, 13 residues, 31 bonds  

> hide sel atoms

> select #1/A:19

9 atoms, 8 bonds, 1 residue, 1 model selected  

> hide sel atoms

> select #1/A:16

5 atoms, 4 bonds, 1 residue, 1 model selected  

> hide sel atoms

> select #1/A:17

5 atoms, 4 bonds, 1 residue, 1 model selected  

> hide sel atoms

> select #1/A:18

5 atoms, 4 bonds, 1 residue, 1 model selected  

> hide sel cartoons

> show sel cartoons

> hide sel atoms

> hide #3 models

> select clear

> show #2 models

> hide #2 models

> show #2 models

> hide #2 models

> show #3 models

> show #2 models

> matchmaker #2 to #3

Parameters  
---  
Chain pairing | bb  
Alignment algorithm | Needleman-Wunsch  
Similarity matrix | BLOSUM-62  
SS fraction | 0.3  
Gap open (HH/SS/other) | 18/18/6  
Gap extend | 1  
SS matrix |  |  | H | S | O  
---|---|---|---  
H | 6 | -9 | -6  
S |  | 6 | -6  
O |  |  | 4  
Iteration cutoff | 2  
  
Matchmaker 6i2g.pdb, chain A (#3) with best_model.pdb, chain B (#2), sequence
alignment score = 641.6  
RMSD between 121 pruned atom pairs is 0.475 angstroms; (across all 121 pairs:
0.475)  
  

> hide #2 models

Drag select of 219 atoms, 163 residues, 181 bonds  

> hide sel atoms

> select clear

Drag select of 46 residues  
[Repeated 1 time(s)]

> show sel atoms

> select clear

> select #1/A:16

5 atoms, 4 bonds, 1 residue, 1 model selected  

> select up

205 atoms, 205 bonds, 27 residues, 1 model selected  

> select down

5 atoms, 4 bonds, 1 residue, 1 model selected  

> hide #3 models

Drag select of 60 atoms, 18 residues, 45 bonds  

> select subtract #1/A:15

109 atoms, 45 bonds, 17 residues, 1 model selected  

> hide sel atoms

> select clear

> show #3 models

> select clear

> hide #3 models

Drag select of 85 atoms, 15 residues, 72 bonds  

> style sel stick

Changed 132 atom styles  

> style sel stick

Changed 132 atom styles  

> select clear

> undo

> style sel ball

Changed 132 atom styles  

> undo

> nucleotides sel atoms

> style nucleic & sel stick

Changed 0 atom styles  

> color sel byhetero

> select clear

> show #2 models

> hide #2 models

> show #3 models

> select clear

> ui mousemode right label

> label #1/A:13

> label delete residues

[Repeated 2 time(s)]

> label #1/A:13

> label #3/B:12

> ui mousemode right "move label"

> ui mousemode right label

> label #3/A:112

> label #1/A:9

> undo

[Repeated 1 time(s)]

> label delete residues

> undo

> show #3 models

> label #1/A:13

> label #3/B:12

> ui mousemode right "move label"

> ui mousemode right label

> label #1/A:9

> label #3/B:8

> ui mousemode right "move label"

> ui mousemode right label

> label #1/A:6

> label delete residues

[Repeated 1 time(s)]

> label #3/B:5

[Repeated 1 time(s)]

> label delete residues

[Repeated 3 time(s)]

> hide #3 models

> label delete residues

[Repeated 1 time(s)]

> show #3 models

> label #3/A:98

> label delete residues

[Repeated 2 time(s)]

> label #3/A:91

> label delete residues

> label #3/A:91

> label delete residues

> label #3/A:94

> label #3/A:91

> label #3/A:92

> label #3/A:93

> label delete residues

> label #1/A:13

> label #3/B:12

> label #1/A:9

> label #3/B:8

> label #3/B:4

> label #1/A:5

> label #3/B:5

> label delete residues

> label #1/A:6

> label #3/B:5

> ui mousemode right "move label"

> ui mousemode right label

> label delete residues

> ui mousemode right select

> select #1/A:6

9 atoms, 8 bonds, 1 residue, 1 model selected  

> select #1/A:6

9 atoms, 8 bonds, 1 residue, 1 model selected  

> select #1/A:5

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select #1/A:6

9 atoms, 8 bonds, 1 residue, 1 model selected  
Drag select of 14 atoms, 7 residues, 11 bonds  

> select clear

> select #1/A:6

9 atoms, 8 bonds, 1 residue, 1 model selected  

> select #1/A:6

9 atoms, 8 bonds, 1 residue, 1 model selected  

> select #1/A:6

9 atoms, 8 bonds, 1 residue, 1 model selected  

> select #3/B:6

9 atoms, 8 bonds, 1 residue, 1 model selected  

> select #1/A:6

9 atoms, 8 bonds, 1 residue, 1 model selected  
Drag select of 18 atoms, 10 residues, 17 bonds  

> select #1/A:6@CB

1 atom, 1 residue, 1 model selected  

> hide sel atoms

[Repeated 1 time(s)]

> select #1/A:6

9 atoms, 8 bonds, 1 residue, 1 model selected  

> hide sel atoms

> select clear

> select add #3/B:5@OE2

1 atom, 4 bonds, 1 residue, 1 model selected  

> select add #3/B:5@OE1

2 atoms, 4 bonds, 1 residue, 1 model selected  

> hide sel atoms

[Repeated 1 time(s)]

> select clear

> select add #3/B:5@CD

1 atom, 3 bonds, 1 residue, 1 model selected  

> hide sel atoms

[Repeated 2 time(s)]

> select #1/A:5

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select #3/B:5

9 atoms, 8 bonds, 1 residue, 1 model selected  

> hide sel atoms

> select clear

[Repeated 1 time(s)]

> volume style image

No volumes specified  

> volume style image

No volumes specified  

> volume style image

No volumes specified  

> ui mousemode right "move label"

> ui mousemode right label

> label #3/B:12

> label #1/A:13

> label #1/A:9

> label #3/B:8

> label #1/A:5

> label delete residues

> label #3/B:4

> label #1/A:5

> label #3/B:8

> label #1/A:9

> label #3/B:12

> label #1/A:13

> ui mousemode right "move label"

> save "C:/Users/shard/Downloads/ChimeraX/ALFA-tag hydrophobic interaction
> view.png" width 959 height 596 supersample 3

> save "C:/Users/shard/Downloads/ChimeraX/ALFA-tag hydrophobic interaction
> view 2.png" width 959 height 596 supersample 3

[Repeated 1 time(s)]

> ui mousemode right label

> label delete residues

> select #1/A

4407 atoms, 4520 bonds, 560 residues, 1 model selected  

> select subtract #1

Nothing selected  

> select add #2

1275 atoms, 1299 bonds, 165 residues, 1 model selected  

> select subtract #2

Nothing selected  

> select add #3

1194 atoms, 1091 bonds, 256 residues, 1 model selected  

> select subtract #3

Nothing selected  

> select add #3

1194 atoms, 1091 bonds, 256 residues, 1 model selected  

> select subtract #3

Nothing selected  

> select #3/A

1045 atoms, 956 bonds, 227 residues, 1 model selected  

> hide #3 models

> show #3 models

> hide sel cartoons

> label delete residues

[Repeated 2 time(s)]

> ui mousemode right select

Drag select of 44 atoms, 15 residues, 36 bonds  
Drag select of 154 atoms, 30 residues, 133 bonds  

> select clear

Drag select of 162 atoms, 31 residues, 137 bonds  

> select subtract #1/A:17

264 atoms, 137 bonds, 30 residues, 2 models selected  

> select subtract #1/A:16

259 atoms, 137 bonds, 29 residues, 2 models selected  

> show sel atoms

> select clear

> select add #3

1194 atoms, 1091 bonds, 256 residues, 1 model selected  

> select subtract #3

Nothing selected  

> select add #3

1194 atoms, 1091 bonds, 256 residues, 1 model selected  

> show sel cartoons

> select clear

[Repeated 1 time(s)]

> select #3/A:112

8 atoms, 7 bonds, 1 residue, 1 model selected  

> show sel atoms

> select clear

Drag select of 147 atoms, 46 residues, 128 bonds  

> select clear

Drag select of 66 atoms, 33 residues, 54 bonds  

> hide sel atoms

> select clear

> select #1/A:12

11 atoms, 10 bonds, 1 residue, 1 model selected  
Drag select of 4 residues  

> show sel atoms

> select clear

> select #1/A:13@CG

1 atom, 1 residue, 1 model selected  
Drag select of 1 atoms, 2 residues  

> hide sel atoms

> select clear

> select #3/A:42

12 atoms, 12 bonds, 1 residue, 1 model selected  

> show sel atoms

> select clear

> ui mousemode right label

> label #1/A:12

> label #3/B:11

> ui mousemode right "move label"

> ui mousemode right label

> label delete residues

> label #1/A:12

> label #3/B:11

> label #3/A:42

> label delete residues

> label #3/A:42

> label #3/A:112

> label delete residues

> label #1/A:12

> label #3/B:11

> label delete residues

> label #3/A:112

> label #3/B:11

> label #1/A:12

> label #3/A:42

> ui mousemode right "move label"

> save "C:/Users/shard/Downloads/ChimeraX/ALFA-tag hydrophilic interaction
> .png" width 959 height 596 supersample 3

> save C:/Users/shard/Downloads/ChimeraX/N-ALFA-EAAK_Nb.cxs

> open "C:/Users/shard/Downloads/ChimeraX/N-ALFA_SPPL2a_ALFA-nanobody PDB
> based.cxs"

Unable to restore session, resetting.  
  
Traceback (most recent call last):  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 700, in restore  
self.reset()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 541, in reset  
sm.reset_state(container, self)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 149, in reset_state  
self.clear()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 45, in delete_all_rotations  
for rotater in self.bond_rotaters.values():  
AttributeError: 'list' object has no attribute 'values'  
  
Traceback (most recent call last):  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 700, in restore  
self.reset()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 541, in reset  
sm.reset_state(container, self)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 149, in reset_state  
self.clear()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 45, in delete_all_rotations  
for rotater in self.bond_rotaters.values():  
AttributeError: 'list' object has no attribute 'values'  
  
During handling of the above exception, another exception occurred:  
  
Traceback (most recent call last):  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\dialog.py", line 162, in _qt_safe  
run(session, "open " + " ".join([FileNameArg.unparse(p) for p in paths]) + (""  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\commands\run.py", line 38, in run  
results = command.run(text, log=log, return_json=return_json)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\commands\cli.py", line 2897, in run  
result = ci.function(session, **kw_args)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\cmd.py", line 119, in cmd_open  
models = Command(session, registry=registry).run(provider_cmd_text,
log=log)[0]  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\commands\cli.py", line 2897, in run  
result = ci.function(session, **kw_args)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\cmd.py", line 194, in provider_open  
models, status = collated_open(session, None, [data], data_format,
_add_models,  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\cmd.py", line 465, in collated_open  
return remember_data_format()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\cmd.py", line 435, in remember_data_format  
models, status = func(*func_args, **func_kw)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core_formats\\__init__.py", line 26, in open  
return cxs_open(session, data, **kw)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 1004, in open  
session.restore(stream, path=path, resize_window=resize_window)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 742, in restore  
self.reset()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 541, in reset  
sm.reset_state(container, self)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 149, in reset_state  
self.clear()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 45, in delete_all_rotations  
for rotater in self.bond_rotaters.values():  
AttributeError: 'list' object has no attribute 'values'  
  
AttributeError: 'list' object has no attribute 'values'  
  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 45, in delete_all_rotations  
for rotater in self.bond_rotaters.values():  
  
See log for complete Python traceback.  
  

> open C:\Users\shard\Downloads\ChimeraX\N-ALFA-EAAK_Nb.cxs format session

Unable to restore session, resetting.  
  
Traceback (most recent call last):  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 700, in restore  
self.reset()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 541, in reset  
sm.reset_state(container, self)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 149, in reset_state  
self.clear()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 45, in delete_all_rotations  
for rotater in self.bond_rotaters.values():  
AttributeError: 'list' object has no attribute 'values'  
  
Traceback (most recent call last):  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 700, in restore  
self.reset()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 541, in reset  
sm.reset_state(container, self)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 149, in reset_state  
self.clear()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 45, in delete_all_rotations  
for rotater in self.bond_rotaters.values():  
AttributeError: 'list' object has no attribute 'values'  
  
During handling of the above exception, another exception occurred:  
  
Traceback (most recent call last):  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\ui\widgets\htmlview.py", line 320, in interceptRequest  
self._callback(info)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\ui\widgets\htmlview.py", line 93, in _intercept  
return interceptor(request_info, *args)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\ui\widgets\htmlview.py", line 353, in intercept  
chimerax_intercept(*args, view=view, session=session)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\ui\widgets\htmlview.py", line 455, in chimerax_intercept  
session.ui.thread_safe(defer, session, qurl.url(no_formatting), from_dir)  
File "C:\Program Files\ChimeraX\bin\lib\site-packages\chimerax\ui\gui.py",
line 368, in thread_safe  
func(*args, **kw)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\ui\widgets\htmlview.py", line 446, in defer  
cxcmd(session, topic)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\ui\widgets\htmlview.py", line 464, in cxcmd  
run(session, cmd)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\commands\run.py", line 38, in run  
results = command.run(text, log=log, return_json=return_json)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\commands\cli.py", line 2897, in run  
result = ci.function(session, **kw_args)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\cmd.py", line 119, in cmd_open  
models = Command(session, registry=registry).run(provider_cmd_text,
log=log)[0]  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\commands\cli.py", line 2897, in run  
result = ci.function(session, **kw_args)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\cmd.py", line 194, in provider_open  
models, status = collated_open(session, None, [data], data_format,
_add_models,  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\cmd.py", line 465, in collated_open  
return remember_data_format()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\cmd.py", line 435, in remember_data_format  
models, status = func(*func_args, **func_kw)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core_formats\\__init__.py", line 26, in open  
return cxs_open(session, data, **kw)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 1004, in open  
session.restore(stream, path=path, resize_window=resize_window)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 742, in restore  
self.reset()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 541, in reset  
sm.reset_state(container, self)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 149, in reset_state  
self.clear()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 45, in delete_all_rotations  
for rotater in self.bond_rotaters.values():  
AttributeError: 'list' object has no attribute 'values'  
  
AttributeError: 'list' object has no attribute 'values'  
  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 45, in delete_all_rotations  
for rotater in self.bond_rotaters.values():  
  
See log for complete Python traceback.  
  

> open C:\Users\shard\Downloads\ChimeraX\N-ALFA-EAAK_Nb.cxs format session

Unable to restore session, resetting.  
  
Traceback (most recent call last):  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 700, in restore  
self.reset()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 541, in reset  
sm.reset_state(container, self)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 149, in reset_state  
self.clear()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 45, in delete_all_rotations  
for rotater in self.bond_rotaters.values():  
AttributeError: 'list' object has no attribute 'values'  
  
Traceback (most recent call last):  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 700, in restore  
self.reset()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 541, in reset  
sm.reset_state(container, self)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 149, in reset_state  
self.clear()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 45, in delete_all_rotations  
for rotater in self.bond_rotaters.values():  
AttributeError: 'list' object has no attribute 'values'  
  
During handling of the above exception, another exception occurred:  
  
Traceback (most recent call last):  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\ui\widgets\htmlview.py", line 320, in interceptRequest  
self._callback(info)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\ui\widgets\htmlview.py", line 93, in _intercept  
return interceptor(request_info, *args)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\ui\widgets\htmlview.py", line 353, in intercept  
chimerax_intercept(*args, view=view, session=session)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\ui\widgets\htmlview.py", line 455, in chimerax_intercept  
session.ui.thread_safe(defer, session, qurl.url(no_formatting), from_dir)  
File "C:\Program Files\ChimeraX\bin\lib\site-packages\chimerax\ui\gui.py",
line 368, in thread_safe  
func(*args, **kw)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\ui\widgets\htmlview.py", line 446, in defer  
cxcmd(session, topic)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\ui\widgets\htmlview.py", line 464, in cxcmd  
run(session, cmd)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\commands\run.py", line 38, in run  
results = command.run(text, log=log, return_json=return_json)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\commands\cli.py", line 2897, in run  
result = ci.function(session, **kw_args)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\cmd.py", line 119, in cmd_open  
models = Command(session, registry=registry).run(provider_cmd_text,
log=log)[0]  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\commands\cli.py", line 2897, in run  
result = ci.function(session, **kw_args)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\cmd.py", line 194, in provider_open  
models, status = collated_open(session, None, [data], data_format,
_add_models,  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\cmd.py", line 465, in collated_open  
return remember_data_format()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\cmd.py", line 435, in remember_data_format  
models, status = func(*func_args, **func_kw)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core_formats\\__init__.py", line 26, in open  
return cxs_open(session, data, **kw)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 1004, in open  
session.restore(stream, path=path, resize_window=resize_window)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 742, in restore  
self.reset()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 541, in reset  
sm.reset_state(container, self)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 149, in reset_state  
self.clear()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 45, in delete_all_rotations  
for rotater in self.bond_rotaters.values():  
AttributeError: 'list' object has no attribute 'values'  
  
AttributeError: 'list' object has no attribute 'values'  
  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 45, in delete_all_rotations  
for rotater in self.bond_rotaters.values():  
  
See log for complete Python traceback.  
  

> open C:\Users\shard\Downloads\ChimeraX\N-ALFA-EAAK_Nb.cxs format session

Unable to restore session, resetting.  
  
Traceback (most recent call last):  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 700, in restore  
self.reset()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 541, in reset  
sm.reset_state(container, self)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 149, in reset_state  
self.clear()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 45, in delete_all_rotations  
for rotater in self.bond_rotaters.values():  
AttributeError: 'list' object has no attribute 'values'  
  
Traceback (most recent call last):  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 700, in restore  
self.reset()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 541, in reset  
sm.reset_state(container, self)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 149, in reset_state  
self.clear()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 45, in delete_all_rotations  
for rotater in self.bond_rotaters.values():  
AttributeError: 'list' object has no attribute 'values'  
  
During handling of the above exception, another exception occurred:  
  
Traceback (most recent call last):  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\ui\widgets\htmlview.py", line 320, in interceptRequest  
self._callback(info)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\ui\widgets\htmlview.py", line 93, in _intercept  
return interceptor(request_info, *args)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\ui\widgets\htmlview.py", line 353, in intercept  
chimerax_intercept(*args, view=view, session=session)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\ui\widgets\htmlview.py", line 455, in chimerax_intercept  
session.ui.thread_safe(defer, session, qurl.url(no_formatting), from_dir)  
File "C:\Program Files\ChimeraX\bin\lib\site-packages\chimerax\ui\gui.py",
line 368, in thread_safe  
func(*args, **kw)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\ui\widgets\htmlview.py", line 446, in defer  
cxcmd(session, topic)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\ui\widgets\htmlview.py", line 464, in cxcmd  
run(session, cmd)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\commands\run.py", line 38, in run  
results = command.run(text, log=log, return_json=return_json)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\commands\cli.py", line 2897, in run  
result = ci.function(session, **kw_args)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\cmd.py", line 119, in cmd_open  
models = Command(session, registry=registry).run(provider_cmd_text,
log=log)[0]  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\commands\cli.py", line 2897, in run  
result = ci.function(session, **kw_args)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\cmd.py", line 194, in provider_open  
models, status = collated_open(session, None, [data], data_format,
_add_models,  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\cmd.py", line 465, in collated_open  
return remember_data_format()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\open_command\cmd.py", line 435, in remember_data_format  
models, status = func(*func_args, **func_kw)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core_formats\\__init__.py", line 26, in open  
return cxs_open(session, data, **kw)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 1004, in open  
session.restore(stream, path=path, resize_window=resize_window)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 742, in restore  
self.reset()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\core\session.py", line 541, in reset  
sm.reset_state(container, self)  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 149, in reset_state  
self.clear()  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 45, in delete_all_rotations  
for rotater in self.bond_rotaters.values():  
AttributeError: 'list' object has no attribute 'values'  
  
AttributeError: 'list' object has no attribute 'values'  
  
File "C:\Program Files\ChimeraX\bin\lib\site-
packages\chimerax\bond_rot\manager.py", line 45, in delete_all_rotations  
for rotater in self.bond_rotaters.values():  
  
See log for complete Python traceback.  
  




OpenGL version: 3.3.0 NVIDIA 528.79
OpenGL renderer: NVIDIA GeForce RTX 3050 Laptop GPU/PCIe/SSE2
OpenGL vendor: NVIDIA Corporation

Python: 3.9.11
Locale: en_IN.cp1252
Qt version: PyQt6 6.4.2, Qt 6.4.2
Qt runtime version: 6.4.3
Qt platform: windows

Manufacturer: Dell Inc.
Model: Dell G15 5515
OS: Microsoft Windows 11 Home Single Language (Build 22621)
Memory: 16,483,872,768
MaxProcessMemory: 137,438,953,344
CPU: 12 AMD Ryzen 5 5600H with Radeon Graphics         
OSLanguage: en-US

Installed Packages:
    alabaster: 0.7.13
    appdirs: 1.4.4
    asttokens: 2.2.1
    Babel: 2.12.1
    backcall: 0.2.0
    beautifulsoup4: 4.11.2
    blockdiag: 3.0.0
    build: 0.10.0
    certifi: 2023.5.7
    cftime: 1.6.2
    charset-normalizer: 3.1.0
    ChimeraX-AddCharge: 1.5.9.1
    ChimeraX-AddH: 2.2.5
    ChimeraX-AlignmentAlgorithms: 2.0.1
    ChimeraX-AlignmentHdrs: 3.3.1
    ChimeraX-AlignmentMatrices: 2.1
    ChimeraX-Alignments: 2.9.3
    ChimeraX-AlphaFold: 1.0
    ChimeraX-AltlocExplorer: 1.0.3
    ChimeraX-AmberInfo: 1.0
    ChimeraX-Arrays: 1.1
    ChimeraX-Atomic: 1.43.10
    ChimeraX-AtomicLibrary: 10.0.6
    ChimeraX-AtomSearch: 2.0.1
    ChimeraX-AxesPlanes: 2.3.2
    ChimeraX-BasicActions: 1.1.2
    ChimeraX-BILD: 1.0
    ChimeraX-BlastProtein: 2.1.2
    ChimeraX-BondRot: 2.0.1
    ChimeraX-BugReporter: 1.0.1
    ChimeraX-BuildStructure: 2.8
    ChimeraX-Bumps: 1.0
    ChimeraX-BundleBuilder: 1.2.2
    ChimeraX-ButtonPanel: 1.0.1
    ChimeraX-CageBuilder: 1.0.1
    ChimeraX-CellPack: 1.0
    ChimeraX-Centroids: 1.3.2
    ChimeraX-ChangeChains: 1.0.2
    ChimeraX-CheckWaters: 1.3.1
    ChimeraX-ChemGroup: 2.0.1
    ChimeraX-Clashes: 2.2.4
    ChimeraX-ColorActions: 1.0.3
    ChimeraX-ColorGlobe: 1.0
    ChimeraX-ColorKey: 1.5.3
    ChimeraX-CommandLine: 1.2.5
    ChimeraX-ConnectStructure: 2.0.1
    ChimeraX-Contacts: 1.0.1
    ChimeraX-Core: 1.6.1
    ChimeraX-CoreFormats: 1.1
    ChimeraX-coulombic: 1.4.2
    ChimeraX-Crosslinks: 1.0
    ChimeraX-Crystal: 1.0
    ChimeraX-CrystalContacts: 1.0.1
    ChimeraX-DataFormats: 1.2.3
    ChimeraX-Dicom: 1.2
    ChimeraX-DistMonitor: 1.4
    ChimeraX-DockPrep: 1.1.1
    ChimeraX-Dssp: 2.0
    ChimeraX-EMDB-SFF: 1.0
    ChimeraX-ESMFold: 1.0
    ChimeraX-FileHistory: 1.0.1
    ChimeraX-FunctionKey: 1.0.1
    ChimeraX-Geometry: 1.3
    ChimeraX-gltf: 1.0
    ChimeraX-Graphics: 1.1.1
    ChimeraX-Hbonds: 2.4
    ChimeraX-Help: 1.2.1
    ChimeraX-HKCage: 1.3
    ChimeraX-IHM: 1.1
    ChimeraX-ImageFormats: 1.2
    ChimeraX-IMOD: 1.0
    ChimeraX-IO: 1.0.1
    ChimeraX-ItemsInspection: 1.0.1
    ChimeraX-Label: 1.1.7
    ChimeraX-ListInfo: 1.1.1
    ChimeraX-Log: 1.1.5
    ChimeraX-LookingGlass: 1.1
    ChimeraX-Maestro: 1.8.2
    ChimeraX-Map: 1.1.4
    ChimeraX-MapData: 2.0
    ChimeraX-MapEraser: 1.0.1
    ChimeraX-MapFilter: 2.0.1
    ChimeraX-MapFit: 2.0
    ChimeraX-MapSeries: 2.1.1
    ChimeraX-Markers: 1.0.1
    ChimeraX-Mask: 1.0.2
    ChimeraX-MatchMaker: 2.0.12
    ChimeraX-MDcrds: 2.6
    ChimeraX-MedicalToolbar: 1.0.2
    ChimeraX-Meeting: 1.0.1
    ChimeraX-MLP: 1.1.1
    ChimeraX-mmCIF: 2.12
    ChimeraX-MMTF: 2.2
    ChimeraX-Modeller: 1.5.9
    ChimeraX-ModelPanel: 1.3.7
    ChimeraX-ModelSeries: 1.0.1
    ChimeraX-Mol2: 2.0
    ChimeraX-Mole: 1.0
    ChimeraX-Morph: 1.0.2
    ChimeraX-MouseModes: 1.2
    ChimeraX-Movie: 1.0
    ChimeraX-Neuron: 1.0
    ChimeraX-Nifti: 1.0
    ChimeraX-NRRD: 1.0
    ChimeraX-Nucleotides: 2.0.3
    ChimeraX-OpenCommand: 1.10.1
    ChimeraX-PDB: 2.7.2
    ChimeraX-PDBBio: 1.0
    ChimeraX-PDBLibrary: 1.0.2
    ChimeraX-PDBMatrices: 1.0
    ChimeraX-PickBlobs: 1.0.1
    ChimeraX-Positions: 1.0
    ChimeraX-PresetMgr: 1.1
    ChimeraX-PubChem: 2.1
    ChimeraX-ReadPbonds: 1.0.1
    ChimeraX-Registration: 1.1.1
    ChimeraX-RemoteControl: 1.0
    ChimeraX-RenderByAttr: 1.1
    ChimeraX-RenumberResidues: 1.1
    ChimeraX-ResidueFit: 1.0.1
    ChimeraX-RestServer: 1.1
    ChimeraX-RNALayout: 1.0
    ChimeraX-RotamerLibMgr: 3.0
    ChimeraX-RotamerLibsDunbrack: 2.0
    ChimeraX-RotamerLibsDynameomics: 2.0
    ChimeraX-RotamerLibsRichardson: 2.0
    ChimeraX-SaveCommand: 1.5.1
    ChimeraX-SchemeMgr: 1.0
    ChimeraX-SDF: 2.0.1
    ChimeraX-Segger: 1.0
    ChimeraX-Segment: 1.0.1
    ChimeraX-SelInspector: 1.0
    ChimeraX-SeqView: 2.8.3
    ChimeraX-Shape: 1.0.1
    ChimeraX-Shell: 1.0.1
    ChimeraX-Shortcuts: 1.1.1
    ChimeraX-ShowSequences: 1.0.1
    ChimeraX-SideView: 1.0.1
    ChimeraX-Smiles: 2.1
    ChimeraX-SmoothLines: 1.0
    ChimeraX-SpaceNavigator: 1.0
    ChimeraX-StdCommands: 1.10.3
    ChimeraX-STL: 1.0.1
    ChimeraX-Storm: 1.0
    ChimeraX-StructMeasure: 1.1.2
    ChimeraX-Struts: 1.0.1
    ChimeraX-Surface: 1.0.1
    ChimeraX-SwapAA: 2.0.1
    ChimeraX-SwapRes: 2.2.1
    ChimeraX-TapeMeasure: 1.0
    ChimeraX-Test: 1.0
    ChimeraX-Toolbar: 1.1.2
    ChimeraX-ToolshedUtils: 1.2.1
    ChimeraX-Topography: 1.0
    ChimeraX-Tug: 1.0.1
    ChimeraX-UI: 1.28.4
    ChimeraX-uniprot: 2.2.2
    ChimeraX-UnitCell: 1.0.1
    ChimeraX-ViewDockX: 1.2
    ChimeraX-VIPERdb: 1.0
    ChimeraX-Vive: 1.1
    ChimeraX-VolumeMenu: 1.0.1
    ChimeraX-VTK: 1.0
    ChimeraX-WavefrontOBJ: 1.0
    ChimeraX-WebCam: 1.0.2
    ChimeraX-WebServices: 1.1.1
    ChimeraX-Zone: 1.0.1
    colorama: 0.4.6
    comm: 0.1.3
    comtypes: 1.1.14
    contourpy: 1.0.7
    cxservices: 1.2.2
    cycler: 0.11.0
    Cython: 0.29.33
    debugpy: 1.6.7
    decorator: 5.1.1
    docutils: 0.19
    executing: 1.2.0
    filelock: 3.9.0
    fonttools: 4.39.3
    funcparserlib: 1.0.1
    grako: 3.16.5
    h5py: 3.8.0
    html2text: 2020.1.16
    idna: 3.4
    ihm: 0.35
    imagecodecs: 2022.9.26
    imagesize: 1.4.1
    importlib-metadata: 6.6.0
    ipykernel: 6.21.1
    ipython: 8.10.0
    ipython-genutils: 0.2.0
    ipywidgets: 8.0.6
    jedi: 0.18.2
    Jinja2: 3.1.2
    jupyter-client: 8.0.2
    jupyter-core: 5.3.0
    jupyterlab-widgets: 3.0.7
    kiwisolver: 1.4.4
    line-profiler: 4.0.2
    lxml: 4.9.2
    lz4: 4.3.2
    MarkupSafe: 2.1.2
    matplotlib: 3.6.3
    matplotlib-inline: 0.1.6
    msgpack: 1.0.4
    nest-asyncio: 1.5.6
    netCDF4: 1.6.2
    networkx: 2.8.8
    nibabel: 5.0.1
    nptyping: 2.5.0
    numexpr: 2.8.4
    numpy: 1.23.5
    openvr: 1.23.701
    packaging: 23.1
    ParmEd: 3.4.3
    parso: 0.8.3
    pep517: 0.13.0
    pickleshare: 0.7.5
    Pillow: 9.3.0
    pip: 23.0
    pkginfo: 1.9.6
    platformdirs: 3.5.0
    prompt-toolkit: 3.0.38
    psutil: 5.9.4
    pure-eval: 0.2.2
    pycollada: 0.7.2
    pydicom: 2.3.0
    Pygments: 2.14.0
    pynrrd: 1.0.0
    PyOpenGL: 3.1.5
    PyOpenGL-accelerate: 3.1.5
    pyparsing: 3.0.9
    pyproject-hooks: 1.0.0
    PyQt6-commercial: 6.4.2
    PyQt6-Qt6: 6.4.3
    PyQt6-sip: 13.4.1
    PyQt6-WebEngine-commercial: 6.4.0
    PyQt6-WebEngine-Qt6: 6.4.3
    python-dateutil: 2.8.2
    pytz: 2023.3
    pywin32: 305
    pyzmq: 25.0.2
    qtconsole: 5.4.0
    QtPy: 2.3.1
    RandomWords: 0.4.0
    requests: 2.28.2
    scipy: 1.9.3
    setuptools: 67.4.0
    sfftk-rw: 0.7.3
    six: 1.16.0
    snowballstemmer: 2.2.0
    sortedcontainers: 2.4.0
    soupsieve: 2.4.1
    sphinx: 6.1.3
    sphinx-autodoc-typehints: 1.22
    sphinxcontrib-applehelp: 1.0.4
    sphinxcontrib-blockdiag: 3.0.0
    sphinxcontrib-devhelp: 1.0.2
    sphinxcontrib-htmlhelp: 2.0.1
    sphinxcontrib-jsmath: 1.0.1
    sphinxcontrib-qthelp: 1.0.3
    sphinxcontrib-serializinghtml: 1.1.5
    stack-data: 0.6.2
    tables: 3.7.0
    tcia-utils: 1.2.0
    tifffile: 2022.10.10
    tinyarray: 1.2.4
    tomli: 2.0.1
    tornado: 6.3.1
    traitlets: 5.9.0
    typing-extensions: 4.5.0
    tzdata: 2023.3
    urllib3: 1.26.15
    wcwidth: 0.2.6
    webcolors: 1.12
    wheel: 0.38.4
    wheel-filename: 1.4.1
    widgetsnbextension: 4.0.7
    WMI: 1.5.1
    zipp: 3.15.0

Change History (2)

comment:1 by Eric Pettersen, 2 years ago

Component: UnassignedSessions
Owner: set to Eric Pettersen
Platform: all
Project: ChimeraX
Status: newaccepted
Summary: ChimeraX bug report submissionRestore new session in old ChimeraX

comment:2 by Eric Pettersen, 2 years ago

Resolution: limitation
Status: acceptedclosed
Note: See TracTickets for help on using tickets.