﻿id	summary	reporter	owner	description	type	status	priority	milestone	component	version	resolution	keywords	cc	blockedby	blocking	notify_on_close	platform	project
8516	glClear: invalid framebuffer operation	chimerax-bug-report@…	Tom Goddard	"{{{
The following bug report has been submitted:
Platform:        macOS-10.16-x86_64-i386-64bit
ChimeraX Version: 1.3 (2021-12-08 23:08:33 UTC)
Description
(Describe the actions that caused this problem to occur here)

Log:
UCSF ChimeraX version: 1.3 (2021-12-08)  
© 2016-2021 Regents of the University of California. All rights reserved.  
How to cite UCSF ChimeraX  

> MKASLQLKMGQQLAMTPQLQQAIRLLQLSTLDLQQEIQEALDSNPLLDVEEEALSTPETLTSPEPQAEKE

Unknown command:
MKASLQLKMGQQLAMTPQLQQAIRLLQLSTLDLQQEIQEALDSNPLLDVEEEALSTPETLTSPEPQAEKE  

> TASAEQETPVTDSSDVIESNNISEELEMDASWDDVYSANSGSTGLAIDDDTPIYQGETTESLQDYLMWQA

Unknown command:
TASAEQETPVTDSSDVIESNNISEELEMDASWDDVYSANSGSTGLAIDDDTPIYQGETTESLQDYLMWQA  

> DLTPFTDLDRTIATTIIESLDEYGYLTSSLDDILESIGDEEVEMDEVEAVLKRIQQFDPLGVASRDLAEC

Unknown command:
DLTPFTDLDRTIATTIIESLDEYGYLTSSLDDILESIGDEEVEMDEVEAVLKRIQQFDPLGVASRDLAEC  

> LLLQLATYPADTPWLPETKLILKDHINLLGNRDYRQLAKETKLKESDLKQVMMLIHELDPRPGNRVIDTE

Unknown command:
LLLQLATYPADTPWLPETKLILKDHINLLGNRDYRQLAKETKLKESDLKQVMMLIHELDPRPGNRVIDTE  

> TEYVIPDVSVFKHNGKWVVTINPDSVPRLKVNAEYAALGKTMGNTPDGQFIRTNLQEAKWLIKSLESRNE

Unknown command:
TEYVIPDVSVFKHNGKWVVTINPDSVPRLKVNAEYAALGKTMGNTPDGQFIRTNLQEAKWLIKSLESRNE  

> TLLKVARCIVEHQQDFFEYGEEAMKPMVLNDIALDVDMHESTISRVTTQKFMHIPRGIFELKYFFSSHVS

Unknown command:
TLLKVARCIVEHQQDFFEYGEEAMKPMVLNDIALDVDMHESTISRVTTQKFMHIPRGIFELKYFFSSHVS  

> TDNGGECSSTAIRALVKKLVAAENQAKPLSDSKIATLLAEQGIQVARRTIAKYRESLGIAPSNQRKRLL

Unknown command:
TDNGGECSSTAIRALVKKLVAAENQAKPLSDSKIATLLAEQGIQVARRTIAKYRESLGIAPSNQRKRLL  

> open /Users/chrismuriel/Desktop/RpoN_VF_2.rtf

Unrecognized file suffix '.rtf'  

> open /Users/chrismuriel/Desktop/RpoN_VF_2.rtf

Unrecognized file suffix '.rtf'  

> open ""/Users/chrismuriel/Desktop/2023_RpoN_alignment
> analysis/Alignment_Analysis/AlignedRPONVcenae Consensus.fa""

Summary of feedback from opening
/Users/chrismuriel/Desktop/2023_RpoN_alignment
analysis/Alignment_Analysis/AlignedRPONVcenae Consensus.fa  
---  
note | Alignment identifier is AlignedRPONVcenae Consensus.fa  
  
Opened 1 sequences from AlignedRPONVcenae Consensus.fa  

> save ""/Users/chrismuriel/Desktop/2023_RpoN_alignment
> analysis/Alignment_Analysis/consensus rpoN"" format aln alignment
> ""AlignedRPONVcenae Consensus.fa""

> open ""/Users/chrismuriel/Desktop/2023_RpoN_alignment
> analysis/Alignment_Analysis/consensus rpoN"" format aln

Summary of feedback from opening
/Users/chrismuriel/Desktop/2023_RpoN_alignment
analysis/Alignment_Analysis/consensus rpoN  
---  
note | Alignment identifier is consensus rpoN  
  
Opened 1 sequences from consensus rpoN  

> open ""/Users/chrismuriel/Desktop/2023_RpoN_alignment
> analysis/Alignment_Analysis/consensus rpoN"" format aln

Summary of feedback from opening
/Users/chrismuriel/Desktop/2023_RpoN_alignment
analysis/Alignment_Analysis/consensus rpoN  
---  
notes | Destroying pre-existing alignment with identifier consensus rpoN  
Alignment identifier is consensus rpoN  
  
Opened 1 sequences from consensus rpoN  

> open ""/Users/chrismuriel/Desktop/2023_RpoN_alignment
> analysis/Alignment_Analysis/consensus rpoN"" format aln

Summary of feedback from opening
/Users/chrismuriel/Desktop/2023_RpoN_alignment
analysis/Alignment_Analysis/consensus rpoN  
---  
notes | Destroying pre-existing alignment with identifier consensus rpoN  
Alignment identifier is consensus rpoN  
  
Opened 1 sequences from consensus rpoN  

> show atoms

[Repeated 2 time(s)]

> open ""/Users/chrismuriel/Desktop/2023_RpoN_alignment
> analysis/Alignment_Analysis/consensus rpoN"" format aln

Summary of feedback from opening
/Users/chrismuriel/Desktop/2023_RpoN_alignment
analysis/Alignment_Analysis/consensus rpoN  
---  
notes | Destroying pre-existing alignment with identifier consensus rpoN  
Alignment identifier is consensus rpoN  
  
Opened 1 sequences from consensus rpoN  

> open ""/Users/chrismuriel/Desktop/2023_RpoN_alignment
> analysis/Alignment_Analysis/consensus rpoN"" format aln

Summary of feedback from opening
/Users/chrismuriel/Desktop/2023_RpoN_alignment
analysis/Alignment_Analysis/consensus rpoN  
---  
note | Alignment identifier is consensus rpoN  
  
Opened 1 sequences from consensus rpoN  

> show # target m

Expected a collection of one of 'atoms', 'bonds', 'cartoons', 'models',
'pbonds', 'pseudobonds', 'ribbons', or 'surfaces' or a keyword  

> open /Users/chrismuriel/Downloads/AF-A0A510UNU5-F1-model_v3.pdb format pdb

Summary of feedback from opening
/Users/chrismuriel/Downloads/AF-A0A510UNU5-F1-model_v3.pdb  
---  
warning | Ignored bad PDB record found on line 38  
DBREF XXXX A 1 489 UNP A0A510UNU5 A0A510UNU5_ALIFS 1 489  
  
AF-A0A510UNU5-F1-model_v3.pdb title:  
Alphafold monomer V2.0 prediction for RNA polymerase σ-54 factor (A0A510UNU5)
[more info...]  
  
Chain information for AF-A0A510UNU5-F1-model_v3.pdb #1  
---  
Chain | Description  
A | RNA polymerase σ-54 factor  
  

> select #1

3850 atoms, 3910 bonds, 489 residues, 1 model selected  
Alignment identifier is 1/A  

> select /A:488-489

17 atoms, 16 bonds, 2 residues, 1 model selected  

> select /A:1-489

3850 atoms, 3910 bonds, 489 residues, 1 model selected  
Destroying pre-existing alignment with identifier 1/A  
Alignment identifier is 1/A  

> select /A:1

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select /A:1-329

2574 atoms, 2614 bonds, 329 residues, 1 model selected  

> select /A:1

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select /A:1-489

3850 atoms, 3910 bonds, 489 residues, 1 model selected  

> select /A:1

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select /A:1-489

3850 atoms, 3910 bonds, 489 residues, 1 model selected  

> ~select #1

Nothing selected  

> select /A:454

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select /A:454-489

284 atoms, 285 bonds, 36 residues, 1 model selected  

> color sel orange

> hide #1 models

> show #1 models

> show target m

[Repeated 2 time(s)]

> hide target m

> show target m

> view clip false

[Repeated 1 time(s)]

> save /Users/chrismuriel/Desktop/image1.png supersample 3

> hide sel cartoons

> show sel cartoons

> hide sel surfaces

[Repeated 2 time(s)]

> hide sel atoms

[Repeated 2 time(s)]

> hide sel cartoons

[Repeated 2 time(s)]

> show sel cartoons

> show sel surfaces

[Repeated 1 time(s)]

> hide sel surfaces

> show sel atoms

> hide sel atoms

> hide #!1 models

> show #!1 models

> select #1

3850 atoms, 3910 bonds, 489 residues, 1 model selected  

> ~select #1

1 model selected  

> select #1

3850 atoms, 3910 bonds, 489 residues, 1 model selected  

> ~select #1

1 model selected  

> select /A:454

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select /A:454-489

284 atoms, 285 bonds, 36 residues, 1 model selected  

> view sel

> lighting soft

[Repeated 1 time(s)]

> lighting simple

> set bgColor gray

> set bgColor white

> select #1

3850 atoms, 3910 bonds, 489 residues, 1 model selected  

> ~select #1

1 model selected  

> set bgColor white

> set bgColor gray

> set bgColor black

> select
> /A:17-27,30-43,132-142,147-158,170-177,184-196,207-216,225-234,236-240,244-250,255-267,272-275,303-305,313-321,326-362,364-369,371-373,379-386,390-397,411-414,429-441,451-460,467-477,482-485

1886 atoms, 1883 bonds, 234 residues, 1 model selected  

> select /A:366

11 atoms, 11 bonds, 1 residue, 1 model selected  

> select /A:366-378

109 atoms, 112 bonds, 13 residues, 1 model selected  

> select /A:366

11 atoms, 11 bonds, 1 residue, 1 model selected  

> select /A:366-382

141 atoms, 144 bonds, 17 residues, 1 model selected  

> color (#!1 & sel) orange red

> set bgColor white

> lighting soft

> lighting simple

> lighting full

> lighting flat

> lighting shadows true intensity 0.5

> lighting simple

> lighting soft

> lighting simple

> set bgColor gray

> set bgColor white

> select #1

3850 atoms, 3910 bonds, 489 residues, 1 model selected  

> ~select #1

1 model selected  

> lighting soft

> nucleotides ladder

[Repeated 1 time(s)]

> nucleotides stubs

> nucleotides atoms

> style nucleic stick

Changed 0 atom styles  

> show atoms

[Repeated 2 time(s)]

> hide atoms

> show cartoons

[Repeated 2 time(s)]

> show surfaces

> hide surfaces

> style stick

Changed 3850 atom styles  

> style stick

Changed 3850 atom styles  

> style sphere

Changed 3850 atom styles  

> color bfactor

3850 atoms, 489 residues, 1 surfaces, atom bfactor range 22.8 to 91.4  

> color bfactor

3850 atoms, 489 residues, 1 surfaces, atom bfactor range 22.8 to 91.4  

> undo

[Repeated 1 time(s)]

> hbonds reveal true

370 hydrogen bonds found  

> ~hbonds

> undo

> select #1

3850 atoms, 3910 bonds, 489 residues, 3 models selected  

> ~select #1

1 model selected  

> select /A:366

11 atoms, 11 bonds, 1 residue, 1 model selected  

> select /A:366-386

169 atoms, 172 bonds, 21 residues, 1 model selected  

> select /A:451

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select /A:451-489

307 atoms, 308 bonds, 39 residues, 1 model selected  

> select /A:366

11 atoms, 11 bonds, 1 residue, 1 model selected  

> select /A:366-379

117 atoms, 120 bonds, 14 residues, 1 model selected  

> select /A:451

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select /A:451-489

307 atoms, 308 bonds, 39 residues, 1 model selected  

> color (#!1 & sel) orange

> select /A:366

11 atoms, 11 bonds, 1 residue, 1 model selected  

> select /A:366-382

141 atoms, 144 bonds, 17 residues, 1 model selected  

> color (#!1 & sel) red

> select /A:451

8 atoms, 7 bonds, 1 residue, 1 model selected  

> select /A:451-489

307 atoms, 308 bonds, 39 residues, 1 model selected  

> select /A:366

11 atoms, 11 bonds, 1 residue, 1 model selected  

> select /A:366-386

169 atoms, 172 bonds, 21 residues, 1 model selected  

> view sel

> select #1

3850 atoms, 3910 bonds, 489 residues, 3 models selected  

> ~select #1

1 model selected  

> lighting soft

[Repeated 1 time(s)]

> lighting shadows true intensity 0.5

> lighting full

> lighting flat

> lighting soft

> lighting full

> ui tool show ""Side View""

> view orient

[Repeated 1 time(s)]

> save ""/Users/chrismuriel/RpoN protein.png"" width 1104 height 668 supersample
> 3

> view

> select /A:56

7 atoms, 6 bonds, 1 residue, 1 model selected  

> select /A:1-56

435 atoms, 436 bonds, 56 residues, 1 model selected  

> select /A:85-86

15 atoms, 14 bonds, 2 residues, 1 model selected  

> select /A:59-86

205 atoms, 207 bonds, 28 residues, 1 model selected  

> select /A:105

7 atoms, 6 bonds, 1 residue, 1 model selected  

> select /A:86-105

159 atoms, 160 bonds, 20 residues, 1 model selected  

> select /A:120-121

15 atoms, 14 bonds, 2 residues, 1 model selected  

> select /A:105-121

117 atoms, 117 bonds, 17 residues, 1 model selected  

> select /A:250-251

16 atoms, 15 bonds, 2 residues, 1 model selected  

> select /A:120-251

1058 atoms, 1076 bonds, 132 residues, 1 model selected  

> select /A:385-386

15 atoms, 14 bonds, 2 residues, 1 model selected  

> select /A:250-386

1100 atoms, 1120 bonds, 137 residues, 1 model selected  

> select /A:386-387

15 atoms, 14 bonds, 2 residues, 1 model selected  

> select /A:386-489

812 atoms, 823 bonds, 104 residues, 1 model selected  
Traceback (most recent call last):  
File
""/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/core/triggerset.py"", line 134, in invoke  
return self._func(self._name, data)  
File
""/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/sideview/tool.py"", line 112, in _redraw  
self.render()  
File
""/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/sideview/tool.py"", line 276, in render  
self.view.draw()  
File
""/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/graphics/view.py"", line 165, in draw  
self._draw_scene(camera, drawings)  
File
""/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/graphics/view.py"", line 215, in _draw_scene  
camera.draw_background(vnum, r)  
File
""/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/graphics/camera.py"", line 184, in draw_background  
render.draw_background()  
File
""/Applications/ChimeraX-1.3.app/Contents/Library/Frameworks/Python.framework/Versions/3.9/lib/python3.9/site-
packages/chimerax/graphics/opengl.py"", line 1166, in draw_background  
GL.glClear(flags)  
File ""src/errorchecker.pyx"", line 58, in
OpenGL_accelerate.errorchecker._ErrorChecker.glCheckError  
OpenGL.error.GLError: GLError(  
err = 1286,  
description = b'invalid framebuffer operation',  
baseOperation = glClear,  
cArguments = (16640,)  
)  
  
Error processing trigger ""frame drawn"":  
OpenGL.error.GLError: GLError(  
err = 1286,  
description = b'invalid framebuffer operation',  
baseOperation = glClear,  
cArguments = (16640,)  
)  
  
File ""src/errorchecker.pyx"", line 58, in
OpenGL_accelerate.errorchecker._ErrorChecker.glCheckError  
  
See log for complete Python traceback.  
  

Back buffer dpr of 2 doesn't match <_NSViewBackingLayer: 0x6000024f34e0>
contents scale of 1 - updating layer to match.  

[Repeated 4 time(s)]

Back buffer dpr of 1 doesn't match <_NSViewBackingLayer: 0x6000024f34e0>
contents scale of 2 - updating layer to match.  

[Repeated 2 time(s)]

Back buffer dpr of 2 doesn't match <_NSViewBackingLayer: 0x6000024f34e0>
contents scale of 1 - updating layer to match.  




OpenGL version: 4.1 INTEL-20.2.44
OpenGL renderer: Intel(R) HD Graphics 615
OpenGL vendor: Intel Inc.Hardware:

    Hardware Overview:

      Model Name: MacBook
      Model Identifier: MacBook10,1
      Processor Name: Dual-Core Intel Core m3
      Processor Speed: 1.2 GHz
      Number of Processors: 1
      Total Number of Cores: 2
      L2 Cache (per Core): 256 KB
      L3 Cache: 4 MB
      Hyper-Threading Technology: Enabled
      Memory: 8 GB
      System Firmware Version: 499.40.2.0.0
      OS Loader Version: 564.40.4~27
      SMC Version (system): 2.42f13

Software:

    System Software Overview:

      System Version: macOS 13.0.1 (22A400)
      Kernel Version: Darwin 22.1.0
      Time since boot: 6 days, 19 hours, 1 minute

Graphics/Displays:

    Intel HD Graphics 615:

      Chipset Model: Intel HD Graphics 615
      Type: GPU
      Bus: Built-In
      VRAM (Dynamic, Max): 1536 MB
      Vendor: Intel
      Device ID: 0x591e
      Revision ID: 0x0002
      Metal Support: Metal 3
      Displays:
        Color LCD:
          Display Type: Built-In Retina LCD
          Resolution: 2304 x 1440 Retina
          Framebuffer Depth: 24-Bit Color (ARGB8888)
          Main Display: Yes
          Mirror: Off
          Online: Yes
          Automatically Adjust Brightness: Yes
          Connection Type: Internal

Locale: (None, 'UTF-8')
PyQt5 5.15.2, Qt 5.15.2
Installed Packages:
    alabaster: 0.7.12
    appdirs: 1.4.4
    appnope: 0.1.2
    Babel: 2.9.1
    backcall: 0.2.0
    blockdiag: 2.0.1
    certifi: 2021.5.30
    cftime: 1.5.1.1
    charset-normalizer: 2.0.9
    ChimeraX-AddCharge: 1.2.2
    ChimeraX-AddH: 2.1.11
    ChimeraX-AlignmentAlgorithms: 2.0
    ChimeraX-AlignmentHdrs: 3.2
    ChimeraX-AlignmentMatrices: 2.0
    ChimeraX-Alignments: 2.2.3
    ChimeraX-AlphaFold: 1.0
    ChimeraX-AltlocExplorer: 1.0.1
    ChimeraX-AmberInfo: 1.0
    ChimeraX-Arrays: 1.0
    ChimeraX-Atomic: 1.31
    ChimeraX-AtomicLibrary: 4.2
    ChimeraX-AtomSearch: 2.0
    ChimeraX-AtomSearchLibrary: 1.0
    ChimeraX-AxesPlanes: 2.0
    ChimeraX-BasicActions: 1.1
    ChimeraX-BILD: 1.0
    ChimeraX-BlastProtein: 2.0
    ChimeraX-BondRot: 2.0
    ChimeraX-BugReporter: 1.0
    ChimeraX-BuildStructure: 2.6.1
    ChimeraX-Bumps: 1.0
    ChimeraX-BundleBuilder: 1.1
    ChimeraX-ButtonPanel: 1.0
    ChimeraX-CageBuilder: 1.0
    ChimeraX-CellPack: 1.0
    ChimeraX-Centroids: 1.2
    ChimeraX-ChemGroup: 2.0
    ChimeraX-Clashes: 2.2.2
    ChimeraX-ColorActions: 1.0
    ChimeraX-ColorGlobe: 1.0
    ChimeraX-ColorKey: 1.5
    ChimeraX-CommandLine: 1.1.5
    ChimeraX-ConnectStructure: 2.0
    ChimeraX-Contacts: 1.0
    ChimeraX-Core: 1.3
    ChimeraX-CoreFormats: 1.1
    ChimeraX-coulombic: 1.3.2
    ChimeraX-Crosslinks: 1.0
    ChimeraX-Crystal: 1.0
    ChimeraX-CrystalContacts: 1.0
    ChimeraX-DataFormats: 1.2.2
    ChimeraX-Dicom: 1.0
    ChimeraX-DistMonitor: 1.1.5
    ChimeraX-DistUI: 1.0
    ChimeraX-Dssp: 2.0
    ChimeraX-EMDB-SFF: 1.0
    ChimeraX-ExperimentalCommands: 1.0
    ChimeraX-FileHistory: 1.0
    ChimeraX-FunctionKey: 1.0
    ChimeraX-Geometry: 1.1
    ChimeraX-gltf: 1.0
    ChimeraX-Graphics: 1.1
    ChimeraX-Hbonds: 2.1.2
    ChimeraX-Help: 1.2
    ChimeraX-HKCage: 1.3
    ChimeraX-IHM: 1.1
    ChimeraX-ImageFormats: 1.2
    ChimeraX-IMOD: 1.0
    ChimeraX-IO: 1.0.1
    ChimeraX-ItemsInspection: 1.0
    ChimeraX-Label: 1.1
    ChimeraX-ListInfo: 1.1.1
    ChimeraX-Log: 1.1.4
    ChimeraX-LookingGlass: 1.1
    ChimeraX-Maestro: 1.8.1
    ChimeraX-Map: 1.1
    ChimeraX-MapData: 2.0
    ChimeraX-MapEraser: 1.0
    ChimeraX-MapFilter: 2.0
    ChimeraX-MapFit: 2.0
    ChimeraX-MapSeries: 2.1
    ChimeraX-Markers: 1.0
    ChimeraX-Mask: 1.0
    ChimeraX-MatchMaker: 2.0.4
    ChimeraX-MDcrds: 2.6
    ChimeraX-MedicalToolbar: 1.0.1
    ChimeraX-Meeting: 1.0
    ChimeraX-MLP: 1.1
    ChimeraX-mmCIF: 2.4
    ChimeraX-MMTF: 2.1
    ChimeraX-Modeller: 1.2.6
    ChimeraX-ModelPanel: 1.2.1
    ChimeraX-ModelSeries: 1.0
    ChimeraX-Mol2: 2.0
    ChimeraX-Morph: 1.0
    ChimeraX-MouseModes: 1.1
    ChimeraX-Movie: 1.0
    ChimeraX-Neuron: 1.0
    ChimeraX-Nucleotides: 2.0.2
    ChimeraX-OpenCommand: 1.7
    ChimeraX-PDB: 2.6.5
    ChimeraX-PDBBio: 1.0
    ChimeraX-PDBLibrary: 1.0.2
    ChimeraX-PDBMatrices: 1.0
    ChimeraX-PickBlobs: 1.0
    ChimeraX-Positions: 1.0
    ChimeraX-PresetMgr: 1.0.1
    ChimeraX-PubChem: 2.1
    ChimeraX-ReadPbonds: 1.0.1
    ChimeraX-Registration: 1.1
    ChimeraX-RemoteControl: 1.0
    ChimeraX-ResidueFit: 1.0
    ChimeraX-RestServer: 1.1
    ChimeraX-RNALayout: 1.0
    ChimeraX-RotamerLibMgr: 2.0.1
    ChimeraX-RotamerLibsDunbrack: 2.0
    ChimeraX-RotamerLibsDynameomics: 2.0
    ChimeraX-RotamerLibsRichardson: 2.0
    ChimeraX-SaveCommand: 1.5
    ChimeraX-SchemeMgr: 1.0
    ChimeraX-SDF: 2.0
    ChimeraX-Segger: 1.0
    ChimeraX-Segment: 1.0
    ChimeraX-SelInspector: 1.0
    ChimeraX-SeqView: 2.4.6
    ChimeraX-Shape: 1.0.1
    ChimeraX-Shell: 1.0
    ChimeraX-Shortcuts: 1.1
    ChimeraX-ShowAttr: 1.0
    ChimeraX-ShowSequences: 1.0
    ChimeraX-SideView: 1.0
    ChimeraX-Smiles: 2.1
    ChimeraX-SmoothLines: 1.0
    ChimeraX-SpaceNavigator: 1.0
    ChimeraX-StdCommands: 1.6.1
    ChimeraX-STL: 1.0
    ChimeraX-Storm: 1.0
    ChimeraX-Struts: 1.0
    ChimeraX-Surface: 1.0
    ChimeraX-SwapAA: 2.0
    ChimeraX-SwapRes: 2.1
    ChimeraX-TapeMeasure: 1.0
    ChimeraX-Test: 1.0
    ChimeraX-Toolbar: 1.1
    ChimeraX-ToolshedUtils: 1.2
    ChimeraX-Tug: 1.0
    ChimeraX-UI: 1.13.7
    ChimeraX-uniprot: 2.2
    ChimeraX-UnitCell: 1.0
    ChimeraX-ViewDockX: 1.0.1
    ChimeraX-VIPERdb: 1.0
    ChimeraX-Vive: 1.1
    ChimeraX-VolumeMenu: 1.0
    ChimeraX-VTK: 1.0
    ChimeraX-WavefrontOBJ: 1.0
    ChimeraX-WebCam: 1.0
    ChimeraX-WebServices: 1.0
    ChimeraX-Zone: 1.0
    colorama: 0.4.4
    cxservices: 1.1
    cycler: 0.11.0
    Cython: 0.29.24
    decorator: 5.1.0
    docutils: 0.17.1
    filelock: 3.0.12
    funcparserlib: 0.3.6
    grako: 3.16.5
    h5py: 3.6.0
    html2text: 2020.1.16
    idna: 3.3
    ihm: 0.21
    imagecodecs: 2021.4.28
    imagesize: 1.3.0
    ipykernel: 5.5.5
    ipython: 7.23.1
    ipython-genutils: 0.2.0
    jedi: 0.18.0
    Jinja2: 3.0.1
    jupyter-client: 6.1.12
    jupyter-core: 4.9.1
    kiwisolver: 1.3.2
    lxml: 4.6.3
    lz4: 3.1.3
    MarkupSafe: 2.0.1
    matplotlib: 3.4.3
    matplotlib-inline: 0.1.3
    msgpack: 1.0.2
    netCDF4: 1.5.7
    networkx: 2.6.3
    numexpr: 2.8.0
    numpy: 1.21.2
    openvr: 1.16.801
    packaging: 21.0
    ParmEd: 3.2.0
    parso: 0.8.3
    pexpect: 4.8.0
    pickleshare: 0.7.5
    Pillow: 8.3.2
    pip: 21.2.4
    pkginfo: 1.7.1
    prompt-toolkit: 3.0.23
    psutil: 5.8.0
    ptyprocess: 0.7.0
    pycollada: 0.7.1
    pydicom: 2.1.2
    Pygments: 2.10.0
    PyOpenGL: 3.1.5
    PyOpenGL-accelerate: 3.1.5
    pyparsing: 3.0.6
    PyQt5-commercial: 5.15.2
    PyQt5-sip: 12.8.1
    PyQtWebEngine-commercial: 5.15.2
    python-dateutil: 2.8.2
    pytz: 2021.3
    pyzmq: 22.3.0
    qtconsole: 5.1.1
    QtPy: 1.11.3
    RandomWords: 0.3.0
    requests: 2.26.0
    scipy: 1.7.1
    setuptools: 57.5.0
    sfftk-rw: 0.7.1
    six: 1.16.0
    snowballstemmer: 2.2.0
    sortedcontainers: 2.4.0
    Sphinx: 4.2.0
    sphinx-autodoc-typehints: 1.12.0
    sphinxcontrib-applehelp: 1.0.2
    sphinxcontrib-blockdiag: 2.0.0
    sphinxcontrib-devhelp: 1.0.2
    sphinxcontrib-htmlhelp: 2.0.0
    sphinxcontrib-jsmath: 1.0.1
    sphinxcontrib-qthelp: 1.0.3
    sphinxcontrib-serializinghtml: 1.1.5
    suds-jurko: 0.6
    tifffile: 2021.4.8
    tinyarray: 1.2.3
    tornado: 6.1
    traitlets: 5.1.1
    urllib3: 1.26.7
    wcwidth: 0.2.5
    webcolors: 1.11.1
    wheel: 0.37.0
    wheel-filename: 1.3.0

}}}
"	defect	closed	normal		Graphics		nonchimerax						all	ChimeraX
