﻿id	summary	reporter	owner	description	type	status	priority	milestone	component	version	resolution	keywords	cc	blockedby	blocking	notify_on_close	platform	project
14832	Access violation in python_instances_of_class	chimerax-bug-report@…	Eric Pettersen	"{{{
The following bug report has been submitted:
Platform:        Windows-10-10.0.22621
ChimeraX Version: 1.8.dev202403200605 (2024-03-20 06:05:36 UTC)
Description
(Describe the actions that caused this problem to occur here)

Log:
UCSF ChimeraX version: 1.8.dev202403200605 (2024-03-20)  
© 2016-2024 Regents of the University of California. All rights reserved.  
How to cite UCSF ChimeraX  

> open
> C:/Users/piyus/Downloads/ChimeraX/AlphaFold/MNEI_4aaac_unrelaxed_rank_001_alphafold2_ptm_model_3_seed_000.pdb

Chain information for
MNEI_4aaac_unrelaxed_rank_001_alphafold2_ptm_model_3_seed_000.pdb #1  
---  
Chain | Description  
A | No description available  
  

> ui tool show AlphaFold

> alphafold predict
> LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHIAEAAAKEAAAKEAAAKAAEAAAKEAAAKEAAAKAGEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENEGFREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP

Please cite ColabFold: Making protein folding accessible to all. Nature
Methods (2022) if you use these predictions.  
Running AlphaFold prediction  

> open
> C:/Users/piyus/Downloads/ChimeraX/AlphaFold/Mut9_e8977_unrelaxed_rank_001_alphafold2_ptm_model_3_seed_000.pdb

Chain information for
Mut9_e8977_unrelaxed_rank_001_alphafold2_ptm_model_3_seed_000.pdb #2  
---  
Chain | Description  
A | No description available  
  

> hide #1 models

> open
> C:/Users/piyus/Downloads/ChimeraX/AlphaFold/June_L2L2_Luna(Mut9)/af292_unrelaxed_rank_001_alphafold2_ptm_model_5_seed_000.pdb

Chain information for
af292_unrelaxed_rank_001_alphafold2_ptm_model_5_seed_000.pdb #3  
---  
Chain | Description  
A | No description available  
  

> ui tool show Matchmaker

> matchmaker #2 to #3

Parameters  
---  
Chain pairing | bb  
Alignment algorithm | Needleman-Wunsch  
Similarity matrix | BLOSUM-62  
SS fraction | 0.3  
Gap open (HH/SS/other) | 18/18/6  
Gap extend | 1  
SS matrix |  |  | H | S | O  
---|---|---|---  
H | 6 | -9 | -6  
S |  | 6 | -6  
O |  |  | 4  
Iteration cutoff | 2  
  
Matchmaker af292_unrelaxed_rank_001_alphafold2_ptm_model_5_seed_000.pdb, chain
A (#3) with Mut9_e8977_unrelaxed_rank_001_alphafold2_ptm_model_3_seed_000.pdb,
chain A (#2), sequence alignment score = 398.7  
RMSD between 31 pruned atom pairs is 0.992 angstroms; (across all 96 pairs:
7.627)  
  

> alphafold predict
> LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHIAEAAAKEAAAKEAAAKAAEAAAKEAAAKEAAAKAGEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENEGFREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP

Running AlphaFold prediction  

> hide #3 models

> open
> C:/Users/piyus/Downloads/ChimeraX/AlphaFold/Luna(Mut9)_L2L2_June/af292_unrelaxed_rank_001_alphafold2_ptm_model_5_seed_000.pdb

Chain information for
af292_unrelaxed_rank_001_alphafold2_ptm_model_5_seed_000.pdb #4  
---  
Chain | Description  
A | No description available  
  
AlphaFold prediction finished  
Results in C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_7  

> open C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_7\best_model.pdb

Chain information for best_model.pdb #5  
---  
Chain | Description  
A | No description available  
  
AlphaFold prediction finished  
Results in C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_7  

> open C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_7\best_model.pdb

Chain information for best_model.pdb #6  
---  
Chain | Description  
A | No description available  
  

> hide #4 models

> hide #2 models

> hide #6 models

> hide #5 models

> show #6 models

> show #5 models

> hide #5 models

> alphafold predict
> GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENEGFREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPPAEAAAKEAAAKEAAAKAAEAAAKEAAAKEAAAKALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI

Running AlphaFold prediction  

> close #5

AlphaFold prediction finished  
Results in C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_7  

> open C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_7\best_model.pdb

Chain information for best_model.pdb #5  
---  
Chain | Description  
A | No description available  
  

> hide #5 models

> hide #6 models

> show #5 models

AlphaFold prediction finished  
Results in C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_7  

> open C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_7\best_model.pdb

Chain information for best_model.pdb #7  
---  
Chain | Description  
A | No description available  
  

> hide #5 models

> hide #7 models

> open
> C:/Users/piyus/Downloads/Haddock/334804-June_L2L2_Titan_D21N_T1R2_T1R3_summary/cluster1_1.pdb

Summary of feedback from opening
C:/Users/piyus/Downloads/Haddock/334804-June_L2L2_Titan_D21N_T1R2_T1R3_summary/cluster1_1.pdb  
---  
warnings | Ignored bad PDB record found on line 1  
REMARK FILENAME=""complex_16w.pdb0""  
  
Ignored bad PDB record found on line 2  
REMARK ===============================================================  
  
Ignored bad PDB record found on line 3  
REMARK HADDOCK run for complex  
  
Ignored bad PDB record found on line 4  
REMARK initial structure: complex_16.pdb  
  
Ignored bad PDB record found on line 5  
REMARK ===============================================================  
  
29 messages similar to the above omitted  
  
Chain information for cluster1_1.pdb #8  
---  
Chain | Description  
A | No description available  
B | No description available  
  

> color #8 bychain

> coulombic #8

Using Amber 20 recommended default charges and atom types for standard
residues  
Coulombic values for cluster1_1.pdb_A SES surface #8.1: minimum, -12.25, mean
-1.06, maximum 10.98  
Coulombic values for cluster1_1.pdb_B SES surface #8.2: minimum, -17.39, mean
-1.14, maximum 16.54  
To also show corresponding color key, enter the above coulombic command and
add key true  

> alphafold predict
> GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENEGFREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPPAEAAAKEAAAKEAAAKALEAEAAAKEAAAKEAAAKALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI

Running AlphaFold prediction  

> alphafold predict
> GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENEGFREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPPAEAAAKEAAAKEAAAKALEAEAAAKEAAAKEAAAKALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI

Running AlphaFold prediction  

> alphafold predict
> GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENEGFREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPPAEAAAKEAAAKEAAAKALEAEAAAKEAAAKEAAAKALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI

Running AlphaFold prediction  

> close #5

> close #6

> alphafold predict
> GEWEIIDIGPFTQNLGKFAVDEANKIGQYGRLTFNKVIRPAMKKTIYENEGFREIKGYEYQLYVRASDKLFRADIYEDYKTRGRKLLRFNGPVPPPAEAAAKEAAAKEAAAKALEAEAAAKEAAAKEAAAKALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI

Running AlphaFold prediction  

> alphafold predict
> GEWEIIDIGPFTQNLGKFAVDEANKIGQYGRLTFNKVIRPAMKKTIYENEGFREIKGYEYQLYVRASDKLFRADIYEDYKTRGRKLLRFNGPVPPPAEAAAKEAAAKEAAAKALEAEAAAKEAAAKEAAAKALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI

Running AlphaFold prediction  

> alphafold predict
> GEWEIIDIGPFTQNLGKFAVDEANKIGQYGRLTFNKVIRPAMKKTIYENEGFREIKGYEYQLYVRASDKLFRADIYEDYKTRGRKLLRFNGPVPPPAEAAAKEAAAKEAAAKALEAEAAAKEAAAKEAAAKALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI

Running AlphaFold prediction  

> alphafold predict
> GEWEIIDIGPFTQNLGKFAVDEANKIGQYGRLTFNKVIRPAMKKTIYENEGFREIKGYEYQLYVRASDKLFRADIYEDYKTRGRKLLRFNGPVPPPAEAAAKEAAAKEAAAKALEAEAAAKEAAAKEAAAKALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI

Running AlphaFold prediction  

> alphafold predict
> GEWEIIDIGPFTQNLGKFAVDEANKIGQYGRLTFNKVIRPAMKKTIYENEGFREIKGYEYQLYVRASDKLFRADIYEDYKTRGRKLLRFNGPVPPPAEAAAKEAAAKEAAAKALEAEAAAKEAAAKEAAAKALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI

Running AlphaFold prediction  

> alphafold predict
> GEWEIIDIGPFTQNLGKFAVDEANKIGQYGRLTFNKVIRPAMKKTIYENEGFREIKGYEYQLYVRASDKLFRADIYEDYKTRGRKLLRFNGPVPPPAEAAAKEAAAKEAAAKALEAEAAAKEAAAKEAAAKALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI

Running AlphaFold prediction  
Compositor returned null texture  

> alphafold predict
> GEWEIIDIGPFTQNLGKFAVDEANKIGQYGRLTFNKVIRPAMKKTIYENEGFREIKGYEYQLYVRASDKLFRADIYEDYKTRGRKLLRFNGPVPPPAEAAAKEAAAKEAAAKALEAEAAAKEAAAKEAAAKALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI

Running AlphaFold prediction  
AlphaFold prediction finished  
Results in C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_7  

> open C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_7\best_model.pdb

Chain information for best_model.pdb #5  
---  
Chain | Description  
A | No description available  
  

> color #5#!8 bypolymer

> hide #!8 models

> hide #5 models

> show #2 models

> alphafold predict
> GEWEIIDIGPFTQNLGKFAVDEANKIGQYGRLTFNKVIRPAMKKTIYENEGFREIKGYEYQLYVRASDKLFRADIYEDYKTRGRKLLRFNGPVPPPLIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI

Running AlphaFold prediction  
AlphaFold prediction finished  
Results in C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_7  

> open C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_7\best_model.pdb

Chain information for best_model.pdb #6  
---  
Chain | Description  
A | No description available  
  

> hide #6 models

> show #3 models

> hide #3 models

> show #4 models

> hide #4 models

> show #1 models

> open
> C:/Users/piyus/Downloads/Haddock/334804-June_L2L2_Titan_D21N_T1R2_T1R3_summary/cluster6_1.pdb

Summary of feedback from opening
C:/Users/piyus/Downloads/Haddock/334804-June_L2L2_Titan_D21N_T1R2_T1R3_summary/cluster6_1.pdb  
---  
warnings | Ignored bad PDB record found on line 1  
REMARK FILENAME=""complex_21w.pdb0""  
  
Ignored bad PDB record found on line 2  
REMARK ===============================================================  
  
Ignored bad PDB record found on line 3  
REMARK HADDOCK run for complex  
  
Ignored bad PDB record found on line 4  
REMARK initial structure: complex_21.pdb  
  
Ignored bad PDB record found on line 5  
REMARK ===============================================================  
  
29 messages similar to the above omitted  
  
Chain information for cluster6_1.pdb #9  
---  
Chain | Description  
A | No description available  
B | No description available  
  

> hide #2 models

> hide #1 models

> color #9 bypolymer

> coulombic #9

Using Amber 20 recommended default charges and atom types for standard
residues  
Coulombic values for cluster6_1.pdb_A SES surface #9.1: minimum, -12.16, mean
-1.06, maximum 13.29  
Coulombic values for cluster6_1.pdb_B SES surface #9.2: minimum, -21.41, mean
-1.14, maximum 15.49  
To also show corresponding color key, enter the above coulombic command and
add key true  

> color #!9 bypolymer

> show #!8 models

> ui tool show Matchmaker

> matchmaker #!9 to #8

Parameters  
---  
Chain pairing | bb  
Alignment algorithm | Needleman-Wunsch  
Similarity matrix | BLOSUM-62  
SS fraction | 0.3  
Gap open (HH/SS/other) | 18/18/6  
Gap extend | 1  
SS matrix |  |  | H | S | O  
---|---|---|---  
H | 6 | -9 | -6  
S |  | 6 | -6  
O |  |  | 4  
Iteration cutoff | 2  
  
Matchmaker cluster1_1.pdb, chain B (#8) with cluster6_1.pdb, chain B (#9),
sequence alignment score = 8843.1  
RMSD between 1690 pruned atom pairs is 0.170 angstroms; (across all 1691
pairs: 0.177)  
  

> matchmaker #!9 to #8

Parameters  
---  
Chain pairing | bb  
Alignment algorithm | Needleman-Wunsch  
Similarity matrix | BLOSUM-62  
SS fraction | 0.3  
Gap open (HH/SS/other) | 18/18/6  
Gap extend | 1  
SS matrix |  |  | H | S | O  
---|---|---|---  
H | 6 | -9 | -6  
S |  | 6 | -6  
O |  |  | 4  
Iteration cutoff | 2  
  
Matchmaker cluster1_1.pdb, chain B (#8) with cluster6_1.pdb, chain B (#9),
sequence alignment score = 8843.1  
RMSD between 1690 pruned atom pairs is 0.170 angstroms; (across all 1691
pairs: 0.177)  
  

> hide #!8 models

> hide #!9 surfaces

> hide #!9 models

> close #9

> close #5

> alphafold predict
> GEWEIIDIGPFTQNLGKFAVDEANKIGQYGRLTFNKVIRPAMKKTIYENEGFREIKGYEYQLYVRASDKLFRADIYEDYKTRGRKLLRFNGPVPPPPAPAPAPAPAPAPAPAPAPAPLIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI

Running AlphaFold prediction  
AlphaFold prediction finished  
Results in C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_7  

> open C:\Users\piyus/Downloads/ChimeraX/AlphaFold/prediction_7\best_model.pdb

Chain information for best_model.pdb #5  
---  
Chain | Description  
A | No description available  
  

> alphafold predict
> GEWEIIDIGPFTQNLGKFAVDEANKIGQYGRLTFNKVIRPAMKKTIYENEGFREIKGYEYQLYVRASDKLFRADIYEDYKTRGRKLLRFNGPVPPPPAPAPAPAPLIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI

Running AlphaFold prediction  

> hide #5 models

> show #7 models

> hide #7 models

> close #7

> close #6

> open
> C:/Users/piyus/Downloads/Haddock/336112-TitanD21N_L2L2_June_T1R2_T1R3_summary/cluster5_1.pdb

Summary of feedback from opening
C:/Users/piyus/Downloads/Haddock/336112-TitanD21N_L2L2_June_T1R2_T1R3_summary/cluster5_1.pdb  
---  
warnings | Ignored bad PDB record found on line 1  
REMARK FILENAME=""complex_147w.pdb0""  
  
Ignored bad PDB record found on line 2  
REMARK ===============================================================  
  
Ignored bad PDB record found on line 3  
REMARK HADDOCK run for complex  
  
Ignored bad PDB record found on line 4  
REMARK initial structure: complex_147.pdb  
  
Ignored bad PDB record found on line 5  
REMARK ===============================================================  
  
29 messages similar to the above omitted  
  
Chain information for cluster5_1.pdb #6  
---  
Chain | Description  
A | No description available  
B | No description available  
  

> coulombic #6

Using Amber 20 recommended default charges and atom types for standard
residues  
Coulombic values for cluster5_1.pdb_A SES surface #6.1: minimum, -18.06, mean
-0.80, maximum 9.44  
Coulombic values for cluster5_1.pdb_B SES surface #6.2: minimum, -19.34, mean
-1.13, maximum 15.79  
To also show corresponding color key, enter the above coulombic command and
add key true  

> color #!6 bychain

> hide #!6 models

> show #!8 models

> hide #!8 models

> show #4 models

> hide #4 models

> open
> C:/Users/piyus/Downloads/Haddock/336624-June_L7n2_Titan_D21N_T1R2_T1R3_summary/cluster4_1.pdb

Summary of feedback from opening
C:/Users/piyus/Downloads/Haddock/336624-June_L7n2_Titan_D21N_T1R2_T1R3_summary/cluster4_1.pdb  
---  
warnings | Ignored bad PDB record found on line 1  
REMARK FILENAME=""complex_1w.pdb0""  
  
Ignored bad PDB record found on line 2  
REMARK ===============================================================  
  
Ignored bad PDB record found on line 3  
REMARK HADDOCK run for complex  
  
Ignored bad PDB record found on line 4  
REMARK initial structure: complex_1.pdb  
  
Ignored bad PDB record found on line 5  
REMARK ===============================================================  
  
29 messages similar to the above omitted  
  
Chain information for cluster4_1.pdb #7  
---  
Chain | Description  
A | No description available  
B | No description available  
  

> color #7 bychain

> coulombic #7

Traceback (most recent call last):  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\toolbar\tool.py"",
line 205, in callback  
bundle_info.run_provider(session, name, session.toolbar,
display_name=display_name)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\core\toolshed\info.py"", line 397, in run_provider  
return api._api_caller.run_provider(api, session, name, mgr, **kw)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\core\toolshed\\__init__.py"", line 1302, in run_provider  
return cls._get_func(api, ""run_provider"")(session, name, mgr, **kw)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\\__init__.py"", line 66, in run_provider  
shortcuts.run_provider(session, name)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 1387, in run_provider  
keyboard_shortcuts(session).try_shortcut(name)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 402, in try_shortcut  
self.run_shortcut(keys)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 420, in run_shortcut  
sc.run(self.session, status = self._enabled)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 339, in run  
f(s)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 72, in func_plus_tip  
func(cmd + "" %s"")(session)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 593, in run_expanded_command  
run(session, cmd)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 536, in run  
run_command(session, command, **kw)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\core\commands\run.py"", line 49, in run  
results = command.run(text, log=log, return_json=return_json)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\core\commands\cli.py"", line 2904, in run  
result = ci.function(session, **kw_args)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\coulombic\cmd.py"",
line 102, in cmd_coulombic  
assign_charges(session, needs_assignment, his_scheme, charge_method,  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\coulombic\coulombic.py"", line 73, in assign_charges  
charged_struct = struct.copy(name=""copy of "" + struct.name)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\atomic\structure.py"",
line 162, in copy  
m._copy_custom_attrs(self)  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\atomic\structure.py"",
line 176, in _copy_custom_attrs  
py_objs = [py_obj for py_obj in python_instances_of_class(class_obj)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\atomic\molobject.py"",
line 44, in python_instances_of_class  
instances = f(inst_class)  
^^^^^^^^^^^^^  
OSError: exception: access violation reading 0x00000000016FAE56  
  
OSError: exception: access violation reading 0x00000000016FAE56  
  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\atomic\molobject.py"",
line 44, in python_instances_of_class  
instances = f(inst_class)  
^^^^^^^^^^^^^  
  
See log for complete Python traceback.  
  

> coulombic #7

Traceback (most recent call last):  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\toolbar\tool.py"",
line 205, in callback  
bundle_info.run_provider(session, name, session.toolbar,
display_name=display_name)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\core\toolshed\info.py"", line 397, in run_provider  
return api._api_caller.run_provider(api, session, name, mgr, **kw)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\core\toolshed\\__init__.py"", line 1302, in run_provider  
return cls._get_func(api, ""run_provider"")(session, name, mgr, **kw)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\\__init__.py"", line 66, in run_provider  
shortcuts.run_provider(session, name)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 1387, in run_provider  
keyboard_shortcuts(session).try_shortcut(name)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 402, in try_shortcut  
self.run_shortcut(keys)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 420, in run_shortcut  
sc.run(self.session, status = self._enabled)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 339, in run  
f(s)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 72, in func_plus_tip  
func(cmd + "" %s"")(session)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 593, in run_expanded_command  
run(session, cmd)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 536, in run  
run_command(session, command, **kw)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\core\commands\run.py"", line 49, in run  
results = command.run(text, log=log, return_json=return_json)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\core\commands\cli.py"", line 2904, in run  
result = ci.function(session, **kw_args)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\coulombic\cmd.py"",
line 102, in cmd_coulombic  
assign_charges(session, needs_assignment, his_scheme, charge_method,  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\coulombic\coulombic.py"", line 73, in assign_charges  
charged_struct = struct.copy(name=""copy of "" + struct.name)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\atomic\structure.py"",
line 162, in copy  
m._copy_custom_attrs(self)  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\atomic\structure.py"",
line 176, in _copy_custom_attrs  
py_objs = [py_obj for py_obj in python_instances_of_class(class_obj)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\atomic\molobject.py"",
line 44, in python_instances_of_class  
instances = f(inst_class)  
^^^^^^^^^^^^^  
OSError: exception: access violation reading 0x00000000016FAE56  
  
OSError: exception: access violation reading 0x00000000016FAE56  
  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\atomic\molobject.py"",
line 44, in python_instances_of_class  
instances = f(inst_class)  
^^^^^^^^^^^^^  
  
See log for complete Python traceback.  
  

> coulombic #7

Traceback (most recent call last):  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\toolbar\tool.py"",
line 205, in callback  
bundle_info.run_provider(session, name, session.toolbar,
display_name=display_name)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\core\toolshed\info.py"", line 397, in run_provider  
return api._api_caller.run_provider(api, session, name, mgr, **kw)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\core\toolshed\\__init__.py"", line 1302, in run_provider  
return cls._get_func(api, ""run_provider"")(session, name, mgr, **kw)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\\__init__.py"", line 66, in run_provider  
shortcuts.run_provider(session, name)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 1387, in run_provider  
keyboard_shortcuts(session).try_shortcut(name)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 402, in try_shortcut  
self.run_shortcut(keys)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 420, in run_shortcut  
sc.run(self.session, status = self._enabled)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 339, in run  
f(s)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 72, in func_plus_tip  
func(cmd + "" %s"")(session)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 593, in run_expanded_command  
run(session, cmd)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 536, in run  
run_command(session, command, **kw)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\core\commands\run.py"", line 49, in run  
results = command.run(text, log=log, return_json=return_json)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\core\commands\cli.py"", line 2904, in run  
result = ci.function(session, **kw_args)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\coulombic\cmd.py"",
line 102, in cmd_coulombic  
assign_charges(session, needs_assignment, his_scheme, charge_method,  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\coulombic\coulombic.py"", line 73, in assign_charges  
charged_struct = struct.copy(name=""copy of "" + struct.name)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\atomic\structure.py"",
line 162, in copy  
m._copy_custom_attrs(self)  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\atomic\structure.py"",
line 176, in _copy_custom_attrs  
py_objs = [py_obj for py_obj in python_instances_of_class(class_obj)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\atomic\molobject.py"",
line 44, in python_instances_of_class  
instances = f(inst_class)  
^^^^^^^^^^^^^  
OSError: exception: access violation reading 0x00000000016FAE56  
  
OSError: exception: access violation reading 0x00000000016FAE56  
  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\atomic\molobject.py"",
line 44, in python_instances_of_class  
instances = f(inst_class)  
^^^^^^^^^^^^^  
  
See log for complete Python traceback.  
  

> coulombic #7

Traceback (most recent call last):  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\toolbar\tool.py"",
line 205, in callback  
bundle_info.run_provider(session, name, session.toolbar,
display_name=display_name)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\core\toolshed\info.py"", line 397, in run_provider  
return api._api_caller.run_provider(api, session, name, mgr, **kw)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\core\toolshed\\__init__.py"", line 1302, in run_provider  
return cls._get_func(api, ""run_provider"")(session, name, mgr, **kw)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\\__init__.py"", line 66, in run_provider  
shortcuts.run_provider(session, name)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 1387, in run_provider  
keyboard_shortcuts(session).try_shortcut(name)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 402, in try_shortcut  
self.run_shortcut(keys)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 420, in run_shortcut  
sc.run(self.session, status = self._enabled)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 339, in run  
f(s)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 72, in func_plus_tip  
func(cmd + "" %s"")(session)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 593, in run_expanded_command  
run(session, cmd)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 536, in run  
run_command(session, command, **kw)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\core\commands\run.py"", line 49, in run  
results = command.run(text, log=log, return_json=return_json)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\core\commands\cli.py"", line 2904, in run  
result = ci.function(session, **kw_args)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\coulombic\cmd.py"",
line 102, in cmd_coulombic  
assign_charges(session, needs_assignment, his_scheme, charge_method,  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\coulombic\coulombic.py"", line 73, in assign_charges  
charged_struct = struct.copy(name=""copy of "" + struct.name)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\atomic\structure.py"",
line 162, in copy  
m._copy_custom_attrs(self)  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\atomic\structure.py"",
line 176, in _copy_custom_attrs  
py_objs = [py_obj for py_obj in python_instances_of_class(class_obj)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\atomic\molobject.py"",
line 44, in python_instances_of_class  
instances = f(inst_class)  
^^^^^^^^^^^^^  
OSError: exception: access violation reading 0x00000000016FAE56  
  
OSError: exception: access violation reading 0x00000000016FAE56  
  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\atomic\molobject.py"",
line 44, in python_instances_of_class  
instances = f(inst_class)  
^^^^^^^^^^^^^  
  
See log for complete Python traceback.  
  

> color #7 bychain

> color #7 bypolymer

> color #7 bychain

> coulombic #7

Traceback (most recent call last):  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\toolbar\tool.py"",
line 205, in callback  
bundle_info.run_provider(session, name, session.toolbar,
display_name=display_name)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\core\toolshed\info.py"", line 397, in run_provider  
return api._api_caller.run_provider(api, session, name, mgr, **kw)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\core\toolshed\\__init__.py"", line 1302, in run_provider  
return cls._get_func(api, ""run_provider"")(session, name, mgr, **kw)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\\__init__.py"", line 66, in run_provider  
shortcuts.run_provider(session, name)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 1387, in run_provider  
keyboard_shortcuts(session).try_shortcut(name)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 402, in try_shortcut  
self.run_shortcut(keys)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 420, in run_shortcut  
sc.run(self.session, status = self._enabled)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 339, in run  
f(s)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 72, in func_plus_tip  
func(cmd + "" %s"")(session)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 593, in run_expanded_command  
run(session, cmd)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 536, in run  
run_command(session, command, **kw)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\core\commands\run.py"", line 49, in run  
results = command.run(text, log=log, return_json=return_json)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\core\commands\cli.py"", line 2904, in run  
result = ci.function(session, **kw_args)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\coulombic\cmd.py"",
line 102, in cmd_coulombic  
assign_charges(session, needs_assignment, his_scheme, charge_method,  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\coulombic\coulombic.py"", line 73, in assign_charges  
charged_struct = struct.copy(name=""copy of "" + struct.name)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\atomic\structure.py"",
line 162, in copy  
m._copy_custom_attrs(self)  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\atomic\structure.py"",
line 176, in _copy_custom_attrs  
py_objs = [py_obj for py_obj in python_instances_of_class(class_obj)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\atomic\molobject.py"",
line 44, in python_instances_of_class  
instances = f(inst_class)  
^^^^^^^^^^^^^  
OSError: exception: access violation reading 0x00000000016FAE56  
  
OSError: exception: access violation reading 0x00000000016FAE56  
  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\atomic\molobject.py"",
line 44, in python_instances_of_class  
instances = f(inst_class)  
^^^^^^^^^^^^^  
  
See log for complete Python traceback.  
  

> coulombic #7

Traceback (most recent call last):  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\toolbar\tool.py"",
line 205, in callback  
bundle_info.run_provider(session, name, session.toolbar,
display_name=display_name)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\core\toolshed\info.py"", line 397, in run_provider  
return api._api_caller.run_provider(api, session, name, mgr, **kw)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\core\toolshed\\__init__.py"", line 1302, in run_provider  
return cls._get_func(api, ""run_provider"")(session, name, mgr, **kw)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\\__init__.py"", line 66, in run_provider  
shortcuts.run_provider(session, name)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 1387, in run_provider  
keyboard_shortcuts(session).try_shortcut(name)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 402, in try_shortcut  
self.run_shortcut(keys)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 420, in run_shortcut  
sc.run(self.session, status = self._enabled)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 339, in run  
f(s)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 72, in func_plus_tip  
func(cmd + "" %s"")(session)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 593, in run_expanded_command  
run(session, cmd)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 536, in run  
run_command(session, command, **kw)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\core\commands\run.py"", line 49, in run  
results = command.run(text, log=log, return_json=return_json)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\core\commands\cli.py"", line 2904, in run  
result = ci.function(session, **kw_args)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\coulombic\cmd.py"",
line 102, in cmd_coulombic  
assign_charges(session, needs_assignment, his_scheme, charge_method,  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\coulombic\coulombic.py"", line 73, in assign_charges  
charged_struct = struct.copy(name=""copy of "" + struct.name)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\atomic\structure.py"",
line 162, in copy  
m._copy_custom_attrs(self)  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\atomic\structure.py"",
line 176, in _copy_custom_attrs  
py_objs = [py_obj for py_obj in python_instances_of_class(class_obj)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\atomic\molobject.py"",
line 44, in python_instances_of_class  
instances = f(inst_class)  
^^^^^^^^^^^^^  
OSError: exception: access violation reading 0x00000000016FAE56  
  
OSError: exception: access violation reading 0x00000000016FAE56  
  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\atomic\molobject.py"",
line 44, in python_instances_of_class  
instances = f(inst_class)  
^^^^^^^^^^^^^  
  
See log for complete Python traceback.  
  

> mlp #7

Map values for surface ""cluster4_1.pdb_A SES surface"": minimum -27.75, mean
-5.172, maximum 24.07  
Map values for surface ""cluster4_1.pdb_B SES surface"": minimum -27.66, mean
-3.081, maximum 25.04  
To also show corresponding color key, enter the above mlp command and add key
true  

> color #!7 bychain

> coulombic #!7

Traceback (most recent call last):  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\toolbar\tool.py"",
line 205, in callback  
bundle_info.run_provider(session, name, session.toolbar,
display_name=display_name)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\core\toolshed\info.py"", line 397, in run_provider  
return api._api_caller.run_provider(api, session, name, mgr, **kw)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\core\toolshed\\__init__.py"", line 1302, in run_provider  
return cls._get_func(api, ""run_provider"")(session, name, mgr, **kw)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\\__init__.py"", line 66, in run_provider  
shortcuts.run_provider(session, name)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 1387, in run_provider  
keyboard_shortcuts(session).try_shortcut(name)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 402, in try_shortcut  
self.run_shortcut(keys)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 420, in run_shortcut  
sc.run(self.session, status = self._enabled)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 339, in run  
f(s)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 72, in func_plus_tip  
func(cmd + "" %s"")(session)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 593, in run_expanded_command  
run(session, cmd)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 536, in run  
run_command(session, command, **kw)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\core\commands\run.py"", line 49, in run  
results = command.run(text, log=log, return_json=return_json)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\core\commands\cli.py"", line 2904, in run  
result = ci.function(session, **kw_args)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\coulombic\cmd.py"",
line 102, in cmd_coulombic  
assign_charges(session, needs_assignment, his_scheme, charge_method,  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\coulombic\coulombic.py"", line 73, in assign_charges  
charged_struct = struct.copy(name=""copy of "" + struct.name)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\atomic\structure.py"",
line 162, in copy  
m._copy_custom_attrs(self)  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\atomic\structure.py"",
line 176, in _copy_custom_attrs  
py_objs = [py_obj for py_obj in python_instances_of_class(class_obj)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\atomic\molobject.py"",
line 44, in python_instances_of_class  
instances = f(inst_class)  
^^^^^^^^^^^^^  
OSError: exception: access violation writing 0x000001678AB9A210  
  
OSError: exception: access violation writing 0x000001678AB9A210  
  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\atomic\molobject.py"",
line 44, in python_instances_of_class  
instances = f(inst_class)  
^^^^^^^^^^^^^  
  
See log for complete Python traceback.  
  

> coulombic #!7

Traceback (most recent call last):  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\toolbar\tool.py"",
line 205, in callback  
bundle_info.run_provider(session, name, session.toolbar,
display_name=display_name)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\core\toolshed\info.py"", line 397, in run_provider  
return api._api_caller.run_provider(api, session, name, mgr, **kw)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\core\toolshed\\__init__.py"", line 1302, in run_provider  
return cls._get_func(api, ""run_provider"")(session, name, mgr, **kw)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\\__init__.py"", line 66, in run_provider  
shortcuts.run_provider(session, name)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 1387, in run_provider  
keyboard_shortcuts(session).try_shortcut(name)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 402, in try_shortcut  
self.run_shortcut(keys)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 420, in run_shortcut  
sc.run(self.session, status = self._enabled)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 339, in run  
f(s)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 72, in func_plus_tip  
func(cmd + "" %s"")(session)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 593, in run_expanded_command  
run(session, cmd)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\shortcuts\shortcuts.py"", line 536, in run  
run_command(session, command, **kw)  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\core\commands\run.py"", line 49, in run  
results = command.run(text, log=log, return_json=return_json)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\core\commands\cli.py"", line 2904, in run  
result = ci.function(session, **kw_args)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\coulombic\cmd.py"",
line 102, in cmd_coulombic  
assign_charges(session, needs_assignment, his_scheme, charge_method,  
File ""C:\Windows\ChimeraX\bin\Lib\site-
packages\chimerax\coulombic\coulombic.py"", line 73, in assign_charges  
charged_struct = struct.copy(name=""copy of "" + struct.name)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\atomic\structure.py"",
line 162, in copy  
m._copy_custom_attrs(self)  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\atomic\structure.py"",
line 176, in _copy_custom_attrs  
py_objs = [py_obj for py_obj in python_instances_of_class(class_obj)  
^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\atomic\molobject.py"",
line 44, in python_instances_of_class  
instances = f(inst_class)  
^^^^^^^^^^^^^  
OSError: exception: access violation writing 0x000001678AB9A210  
  
OSError: exception: access violation writing 0x000001678AB9A210  
  
File ""C:\Windows\ChimeraX\bin\Lib\site-packages\chimerax\atomic\molobject.py"",
line 44, in python_instances_of_class  
instances = f(inst_class)  
^^^^^^^^^^^^^  
  
See log for complete Python traceback.  
  




OpenGL version: 3.3.0 - Build 30.0.101.1692
OpenGL renderer: Intel(R) UHD Graphics
OpenGL vendor: Intel

Python: 3.11.4
Locale: en_IN.cp1252
Qt version: PyQt6 6.6.1, Qt 6.6.1
Qt runtime version: 6.6.2
Qt platform: windows

Manufacturer: LENOVO
Model: 81X7
OS: Microsoft Windows 11 Home Single Language (Build 22621)
Memory: 8,379,490,304
MaxProcessMemory: 137,438,953,344
CPU: 4 11th Gen Intel(R) Core(TM) i3-1115G4 @ 3.00GHz
OSLanguage: en-US

Installed Packages:
    alabaster: 0.7.16
    appdirs: 1.4.4
    asttokens: 2.4.1
    Babel: 2.14.0
    beautifulsoup4: 4.12.3
    blockdiag: 3.0.0
    blosc2: 2.5.1
    build: 1.1.1
    certifi: 2024.2.2
    cftime: 1.6.3
    charset-normalizer: 3.3.2
    ChimeraX-AddCharge: 1.5.16
    ChimeraX-AddH: 2.2.5
    ChimeraX-AlignmentAlgorithms: 2.0.1
    ChimeraX-AlignmentHdrs: 3.4.3
    ChimeraX-AlignmentMatrices: 2.1
    ChimeraX-Alignments: 2.12.5
    ChimeraX-AlphaFold: 1.0
    ChimeraX-AltlocExplorer: 1.1.1
    ChimeraX-AmberInfo: 1.0
    ChimeraX-Arrays: 1.1
    ChimeraX-Atomic: 1.56
    ChimeraX-AtomicLibrary: 14.0.2
    ChimeraX-AtomSearch: 2.0.1
    ChimeraX-AxesPlanes: 2.4
    ChimeraX-BasicActions: 1.1.2
    ChimeraX-BILD: 1.0
    ChimeraX-BlastProtein: 2.1.2
    ChimeraX-BondRot: 2.0.4
    ChimeraX-BugReporter: 1.0.1
    ChimeraX-BuildStructure: 2.12.1
    ChimeraX-Bumps: 1.0
    ChimeraX-BundleBuilder: 1.2.2
    ChimeraX-ButtonPanel: 1.0.1
    ChimeraX-CageBuilder: 1.0.1
    ChimeraX-CellPack: 1.0
    ChimeraX-Centroids: 1.4
    ChimeraX-ChangeChains: 1.1
    ChimeraX-CheckWaters: 1.4
    ChimeraX-ChemGroup: 2.0.1
    ChimeraX-Clashes: 2.2.4
    ChimeraX-ColorActions: 1.0.3
    ChimeraX-ColorGlobe: 1.0
    ChimeraX-ColorKey: 1.5.5
    ChimeraX-CommandLine: 1.2.5
    ChimeraX-ConnectStructure: 2.0.1
    ChimeraX-Contacts: 1.0.1
    ChimeraX-Core: 1.8.dev202403200605
    ChimeraX-CoreFormats: 1.2
    ChimeraX-coulombic: 1.4.3
    ChimeraX-Crosslinks: 1.0
    ChimeraX-Crystal: 1.0
    ChimeraX-CrystalContacts: 1.0.1
    ChimeraX-DataFormats: 1.2.3
    ChimeraX-Dicom: 1.2
    ChimeraX-DistMonitor: 1.4.2
    ChimeraX-DockPrep: 1.1.3
    ChimeraX-Dssp: 2.0
    ChimeraX-EMDB-SFF: 1.0
    ChimeraX-ESMFold: 1.0
    ChimeraX-FileHistory: 1.0.1
    ChimeraX-FunctionKey: 1.0.1
    ChimeraX-Geometry: 1.3
    ChimeraX-gltf: 1.0
    ChimeraX-Graphics: 1.1.1
    ChimeraX-Hbonds: 2.4
    ChimeraX-Help: 1.2.2
    ChimeraX-HKCage: 1.3
    ChimeraX-IHM: 1.1
    ChimeraX-ImageFormats: 1.2
    ChimeraX-IMOD: 1.0
    ChimeraX-IO: 1.0.1
    ChimeraX-ItemsInspection: 1.0.1
    ChimeraX-IUPAC: 1.0
    ChimeraX-Label: 1.1.9
    ChimeraX-ListInfo: 1.2.2
    ChimeraX-Log: 1.1.6
    ChimeraX-LookingGlass: 1.1
    ChimeraX-Maestro: 1.9.1
    ChimeraX-Map: 1.1.4
    ChimeraX-MapData: 2.0
    ChimeraX-MapEraser: 1.0.1
    ChimeraX-MapFilter: 2.0.1
    ChimeraX-MapFit: 2.0
    ChimeraX-MapSeries: 2.1.1
    ChimeraX-Markers: 1.0.1
    ChimeraX-Mask: 1.0.2
    ChimeraX-MatchMaker: 2.1.3
    ChimeraX-MCopy: 1.0
    ChimeraX-MDcrds: 2.7
    ChimeraX-MedicalToolbar: 1.0.2
    ChimeraX-Meeting: 1.0.1
    ChimeraX-MLP: 1.1.1
    ChimeraX-mmCIF: 2.13
    ChimeraX-MMTF: 2.2
    ChimeraX-Modeller: 1.5.15
    ChimeraX-ModelPanel: 1.5
    ChimeraX-ModelSeries: 1.0.1
    ChimeraX-Mol2: 2.0.3
    ChimeraX-Mole: 1.0
    ChimeraX-Morph: 1.0.2
    ChimeraX-MouseModes: 1.2
    ChimeraX-Movie: 1.0
    ChimeraX-Neuron: 1.0
    ChimeraX-Nifti: 1.1
    ChimeraX-NMRSTAR: 1.0.2
    ChimeraX-NRRD: 1.1
    ChimeraX-Nucleotides: 2.0.3
    ChimeraX-OpenCommand: 1.13.3
    ChimeraX-PDB: 2.7.5
    ChimeraX-PDBBio: 1.0.1
    ChimeraX-PDBLibrary: 1.0.4
    ChimeraX-PDBMatrices: 1.0
    ChimeraX-PickBlobs: 1.0.1
    ChimeraX-Positions: 1.0
    ChimeraX-PresetMgr: 1.1.1
    ChimeraX-PubChem: 2.1
    ChimeraX-ReadPbonds: 1.0.1
    ChimeraX-Registration: 1.1.2
    ChimeraX-RemoteControl: 1.0
    ChimeraX-RenderByAttr: 1.3
    ChimeraX-RenumberResidues: 1.1
    ChimeraX-ResidueFit: 1.0.1
    ChimeraX-RestServer: 1.2
    ChimeraX-RNALayout: 1.0
    ChimeraX-RotamerLibMgr: 4.0
    ChimeraX-RotamerLibsDunbrack: 2.0
    ChimeraX-RotamerLibsDynameomics: 2.0
    ChimeraX-RotamerLibsRichardson: 2.0
    ChimeraX-SaveCommand: 1.5.1
    ChimeraX-SchemeMgr: 1.0
    ChimeraX-SDF: 2.0.2
    ChimeraX-Segger: 1.0
    ChimeraX-Segment: 1.0.1
    ChimeraX-Segmentations: 1.0
    ChimeraX-SelInspector: 1.0
    ChimeraX-SeqView: 2.11.2
    ChimeraX-Shape: 1.0.1
    ChimeraX-Shell: 1.0.1
    ChimeraX-Shortcuts: 1.1.1
    ChimeraX-ShowSequences: 1.0.3
    ChimeraX-SideView: 1.0.1
    ChimeraX-Smiles: 2.1.2
    ChimeraX-SmoothLines: 1.0
    ChimeraX-SpaceNavigator: 1.0
    ChimeraX-StdCommands: 1.16.3
    ChimeraX-STL: 1.0.1
    ChimeraX-Storm: 1.0
    ChimeraX-StructMeasure: 1.2
    ChimeraX-Struts: 1.0.1
    ChimeraX-Surface: 1.0.1
    ChimeraX-SwapAA: 2.0.1
    ChimeraX-SwapRes: 2.5
    ChimeraX-TapeMeasure: 1.0
    ChimeraX-TaskManager: 1.0
    ChimeraX-Test: 1.0
    ChimeraX-Toolbar: 1.1.2
    ChimeraX-ToolshedUtils: 1.2.4
    ChimeraX-Topography: 1.0
    ChimeraX-ToQuest: 1.0
    ChimeraX-Tug: 1.0.1
    ChimeraX-UI: 1.37.1
    ChimeraX-uniprot: 2.3
    ChimeraX-UnitCell: 1.0.1
    ChimeraX-ViewDockX: 1.3.2
    ChimeraX-VIPERdb: 1.0
    ChimeraX-Vive: 1.1
    ChimeraX-VolumeMenu: 1.0.1
    ChimeraX-vrml: 1.0
    ChimeraX-VTK: 1.0
    ChimeraX-WavefrontOBJ: 1.0
    ChimeraX-WebCam: 1.0.2
    ChimeraX-WebServices: 1.1.3
    ChimeraX-Zone: 1.0.1
    colorama: 0.4.6
    comm: 0.2.2
    comtypes: 1.3.1
    contourpy: 1.2.0
    cxservices: 1.2.2
    cycler: 0.12.1
    Cython: 3.0.9
    debugpy: 1.8.1
    decorator: 5.1.1
    docutils: 0.20.1
    executing: 2.0.1
    filelock: 3.13.1
    fonttools: 4.50.0
    funcparserlib: 2.0.0a0
    glfw: 2.7.0
    grako: 3.16.5
    h5py: 3.10.0
    html2text: 2024.2.26
    idna: 3.6
    ihm: 0.43
    imagecodecs: 2024.1.1
    imagesize: 1.4.1
    ipykernel: 6.29.2
    ipython: 8.21.0
    ipywidgets: 8.1.2
    jedi: 0.19.1
    Jinja2: 3.1.3
    jupyter-client: 8.6.0
    jupyter-core: 5.7.2
    jupyterlab-widgets: 3.0.10
    kiwisolver: 1.4.5
    line-profiler: 4.1.2
    lxml: 5.1.0
    lz4: 4.3.3
    MarkupSafe: 2.1.5
    matplotlib: 3.8.3
    matplotlib-inline: 0.1.6
    msgpack: 1.0.8
    ndindex: 1.8
    nest-asyncio: 1.6.0
    netCDF4: 1.6.5
    networkx: 3.2.1
    nibabel: 5.0.1
    nptyping: 2.5.0
    numexpr: 2.9.0
    numpy: 1.26.4
    openvr: 1.26.701
    packaging: 24.0
    ParmEd: 4.2.2
    parso: 0.8.3
    pep517: 0.13.1
    pillow: 10.2.0
    pip: 24.0
    pkginfo: 1.10.0
    platformdirs: 4.2.0
    prompt-toolkit: 3.0.43
    psutil: 5.9.8
    pure-eval: 0.2.2
    py-cpuinfo: 9.0.0
    pycollada: 0.8
    pydicom: 2.3.0
    pygments: 2.17.2
    pynmrstar: 3.3.4
    pynrrd: 1.0.0
    PyOpenGL: 3.1.7
    PyOpenGL-accelerate: 3.1.7
    pyopenxr: 1.0.3302
    pyparsing: 3.1.2
    pyproject-hooks: 1.0.0
    PyQt6-commercial: 6.6.1
    PyQt6-Qt6: 6.6.2
    PyQt6-sip: 13.6.0
    PyQt6-WebEngine-commercial: 6.6.0
    PyQt6-WebEngine-Qt6: 6.6.2
    python-dateutil: 2.9.0.post0
    pytz: 2024.1
    pywin32: 306
    pyzmq: 25.1.2
    qtconsole: 5.5.1
    QtPy: 2.4.1
    RandomWords: 0.4.0
    requests: 2.31.0
    scipy: 1.12.0
    setuptools: 69.2.0
    sfftk-rw: 0.8.1
    six: 1.16.0
    snowballstemmer: 2.2.0
    sortedcontainers: 2.4.0
    soupsieve: 2.5
    sphinx: 7.2.6
    sphinx-autodoc-typehints: 2.0.0
    sphinxcontrib-applehelp: 1.0.8
    sphinxcontrib-blockdiag: 3.0.0
    sphinxcontrib-devhelp: 1.0.6
    sphinxcontrib-htmlhelp: 2.0.5
    sphinxcontrib-jsmath: 1.0.1
    sphinxcontrib-qthelp: 1.0.7
    sphinxcontrib-serializinghtml: 1.1.10
    stack-data: 0.6.3
    superqt: 0.6.1
    tables: 3.9.2
    tcia-utils: 1.5.1
    tifffile: 2024.1.30
    tinyarray: 1.2.4
    tornado: 6.4
    traitlets: 5.14.1
    typing-extensions: 4.10.0
    tzdata: 2024.1
    urllib3: 2.2.1
    wcwidth: 0.2.13
    webcolors: 1.13
    wheel: 0.43.0
    wheel-filename: 1.4.1
    widgetsnbextension: 4.0.10
    WMI: 1.5.1

}}}
"	defect	closed	normal		Core		duplicate		Tom Goddard				all	ChimeraX
